2C56: Uracil DNA glycosylase

A comparative study of uracil DNA glycosylases from human and herpes simplex virus type 1. Determined by X-ray diffraction at 2.1 Å resolution. Released 28 Nov 2005.

Method: X-ray diffraction
Resolution: 2.1 Å
Organism: HUMAN HERPESVIRUS 1
Chains: 1
Atoms: 2,102
Mol. weight: 27.68 kDa
Released: 28 Nov 2005

Explore 2C56 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2C56 contains 15 α-helices and 7 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 15 helices, 7 β-strands

Element	Residues	Length	Sheet
α-helix	19-26	8
α-helix	30-32	3
α-helix	33-36	4
α-helix	37-41	5
α-helix	43-58	16
β-strand	61-62	2	1
α-helix	65-67	3
α-helix	71-74	4
α-helix	77-79	3
β-strand	82-86	5	2
α-helix	108-110	3
α-helix	111-123	13
α-helix	136-140	5
β-strand	143-147	5	2
β-strand	152-153	2	1
β-strand	156	1	1
α-helix	165-179	15
β-strand	184-188	5	2
α-helix	190-195	6
β-strand	204-208	5	2
α-helix	224-234	11
α-helix	238-240	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Uracil DNA glycosylase	A	protein	244	HUMAN HERPESVIRUS 1	P10186

Sequence of entity 1 (A), FASTA

>2C56_1 URACIL DNA GLYCOSYLASE (chains A)
MDLTNGGVSPAATSAPLDWTTFRRVFLIDDAWRPLMEPELANPLTAHLLAEYNRRCQTEE
VLPPREDVFSWTRYCTPDEVRVVIIGQNPYHHPGQAHGLAFSVRANVPPPPSLRNVLAAV
KNCYPEARMSGHGCLEKWARDGVLLLNTTLTVKRGAAASHSRIGWDRFVGGVIRRLAARR
PGLVFMLWGTHAQNAIRPDPRVHCVLKFSNPSPLSKVPFGTCQHFLVANRYLETRSISPI
DWSV

Primary citation

A Comparative Study of Uracil-DNA Glycosylases from Human and Herpes Simplex Virus Type 1. Krusong, K., Carpenter, E.P., Bellamy, S.R.W. et al. J Biol Chem (2006) 281:4983. DOI 10.1074/JBC.M509137200 · PubMed

Other PDB entries of the same protein (UniProt P10186), best resolution first:

1UDG 1.75 Å, The structural basis of specific base excision repair by uracil-DNA glycosylase
1UDH 1.75 Å, The structural basis of specific base excision repair by uracil-DNA glycosylase
1LAU 1.8 Å, Uracil-DNA glycosylase
2C53 1.8 Å, A comparative study of uracil DNA glycosylases from human and herpes simplex virus type 1
5AYS 2.09 Å, Crystal structure of SAUGI/HSV UDG complex
4L5N 2.16 Å, Crystallographic Structure of HHV-1 Uracil-DNA Glycosylase complexed with the Bacillus…
1UDI 2.7 Å, Nucleotide mimicry in the crystal structure of the uracil-DNA glycosylase-uracil…

Browse structure collections

About this viewer

MolViewer shows 2C56 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.