1UDI: Uracil-DNA glycosylase

Nucleotide mimicry in the crystal structure of the uracil-DNA glycosylase-uracil glycosylase inhibitor protein complex. Determined by X-ray diffraction at 2.7 Å resolution. Released 8 Mar 1996.

Method: X-ray diffraction
Resolution: 2.7 Å
Organisms: Herpes simplex virus (type 1 / strain 17), Bacillus phage PBS1
Chains: 2
Atoms: 2,519
Mol. weight: 36.72 kDa
Released: 8 Mar 1996

Explore 1UDI in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1UDI contains 16 α-helices and 12 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain E: 13 helices, 7 β-strands

Element	Residues	Length	Sheet
α-helix	19-26	8
α-helix	30-32	3
α-helix	33-40	8
α-helix	43-55	13
β-strand	61-62	2	1
α-helix	70-72	3
β-strand	82-86	5	2
α-helix	108-110	3
α-helix	111-123	13
α-helix	136-140	5
β-strand	143-147	5	2
β-strand	152-153	2	1
β-strand	156	1	1
α-helix	165-179	15
β-strand	184-188	5	2
α-helix	190-195	6
β-strand	204-208	5	2
α-helix	219-221	3
α-helix	224-234	11
α-helix	237-240	4

Chain I: 3 helices, 5 β-strands

Element	Residues	Length	Sheet
α-helix	3-12	10
α-helix	16-18	3
β-strand	20-24	5	3
α-helix	26-33	8
β-strand	41-48	8	3
β-strand	53-60	8	3
β-strand	67-73	7	3
β-strand	79-83	5	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Uracil-DNA glycosylase	E	protein	244	Herpes simplex virus (type 1 / strain 17)	P10186
Uracil-DNA glycosylase inhibitor protein	I	protein	83	Bacillus phage PBS1	P14739 (AlphaFold model)

Sequence of entity 1 (E), FASTA

>1UDI_1 URACIL-DNA GLYCOSYLASE (chains E)
MDLTNGGVSPAATSAPLDWTTFRRVFLIDDAWRPLMEPELANPLTAHLLAEYNRRCQTEE
VLPPREDVFSWTRYCTPDEVRVVIIGQDPYHHPGQAHGLAFSVRANVPPPPSLRNVLAAV
KNCYPEARMSGHGCLEKWARDGVLLLNTTLTVKRGAAASHSRIGWDRFVGGVIRRLAARR
PGLVFMLWGTHAQNAIRPDPRVHCVLKFSHPSPLSKVPFGTCQHFLVANRYLETRSISPI
DWSV

Sequence of entity 2 (I), FASTA

>1UDI_2 URACIL-DNA GLYCOSYLASE INHIBITOR PROTEIN (chains I)
TNLSDIIEKETGKQLVIQESILMLPEEVEEVIGNKPESDILVHTAYDESTDENVMLLTSD
APEYKPWALVIQDSNGENKIKML

Primary citation

Nucleotide mimicry in the crystal structure of the uracil-DNA glycosylase-uracil glycosylase inhibitor protein complex. Savva, R., Pearl, L.H. Nat Struct Biol (1995) 2:752-757. DOI 10.1038/nsb0995-752 · PubMed

Other PDB entries of the same protein (UniProt P10186), best resolution first:

1UDG 1.75 Å, The structural basis of specific base excision repair by uracil-DNA glycosylase
1UDH 1.75 Å, The structural basis of specific base excision repair by uracil-DNA glycosylase
1LAU 1.8 Å, Uracil-DNA glycosylase
2C53 1.8 Å, A comparative study of uracil DNA glycosylases from human and herpes simplex virus type 1
5AYS 2.09 Å, Crystal structure of SAUGI/HSV UDG complex
2C56 2.1 Å, A comparative study of uracil DNA glycosylases from human and herpes simplex virus type 1
4L5N 2.16 Å, Crystallographic Structure of HHV-1 Uracil-DNA Glycosylase complexed with the Bacillus…

Browse structure collections

About this viewer

MolViewer shows 1UDI directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.