1LM5: Subdomain of Desmoplakin Carboxy-Terminal domain

Structures of two intermediate filament-binding fragments of desmoplakin reveal a unique repeat motif structure. Determined by X-ray diffraction at 1.8 Å resolution. Released 31 Jul 2002.

Method: X-ray diffraction
Resolution: 1.8 Å
Organism: Homo sapiens
Chains: 2
Atoms: 3,212
Mol. weight: 46.6 kDa
Released: 31 Jul 2002

Explore 1LM5 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1LM5 contains 27 α-helices and 22 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 13 helices, 10 β-strands

Element	Residues	Length	Sheet
α-helix	2617-2618	2
β-strand	2619-2624	6	1
β-strand	2629-2631	3	1
α-helix	2633-2638	6
α-helix	2644-2655	12
β-strand	2660-2661	2	2
α-helix	2662	1
β-strand	2668-2669	2	2
α-helix	2671-2676	6
α-helix	2682-2696	15
α-helix	2709-2714	6
α-helix	2720-2732	13
β-strand	2737	1	3
α-helix	2739-2741	3
β-strand	2744	1	3
α-helix	2747-2752	6
α-helix	2758-2765	8
α-helix	2767-2769	3
β-strand	2774-2775	2	4
β-strand	2782-2783	2	4
α-helix	2785-2791	7
β-strand	2793-2794	2	1
β-strand	2801-2805	5	1

Chain B: 14 helices, 12 β-strands

Element	Residues	Length	Sheet
α-helix	2617-2618	2
β-strand	2619-2624	6	5
β-strand	2629-2631	3	5
α-helix	2633-2638	6
α-helix	2644-2655	12
β-strand	2660-2661	2	6
α-helix	2662	1
β-strand	2668-2669	2	6
α-helix	2671-2676	6
α-helix	2682-2696	15
β-strand	2698	1	7
α-helix	2706	1
β-strand	2707	1	7
α-helix	2708	1
α-helix	2709-2714	6
α-helix	2720-2732	13
β-strand	2737-2738	2	8
β-strand	2743-2744	2	8
α-helix	2747-2753	7
α-helix	2758-2765	8
α-helix	2767-2769	3
β-strand	2774-2775	2	9
β-strand	2782-2783	2	9
α-helix	2785-2791	7
β-strand	2793-2794	2	5
β-strand	2801-2805	5	5

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
subdomain of Desmoplakin Carboxy-Terminal domain (DPCT)	A, B	protein	214	Homo sapiens	P15924 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>1LM5_1 subdomain of Desmoplakin Carboxy-Terminal domain (DPCT) (chains A, B)
FSDTLEESSPIAAIFDTENLEKISITEGIERGIVDSITGQRLLEAQACTGGIIHPTTGQK
LSLQDAVSQGVIDQDMATRLKPAQKAFIGFEGVKGKKKMSAAEAVKEKWLPYEAGQRFLE
FQYLTGGLVDPEVHGRISTEEAIRKGFIDGRAAQRLQDTSSYAKILTCPKTKLKISYKDA
INRSMVEDITGLRLLEAASVSSKGLPSPYNMSSA

Primary citation

Structures of two intermediate filament-binding fragments of desmoplakin reveal a unique repeat motif structure. Choi, H.J., Park-Snyder, S., Pascoe, L.T. et al. Nat Struct Biol (2002) 9:612-620. PubMed

Other PDB entries of the same protein (UniProt P15924 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5DZZ 2.6 Å, Structural characterization of intermediate filaments binding domain of desmoplakin
3R6N 2.95 Å, Crystal structure of a rigid four spectrin repeat fragment of the human desmoplakin…
1LM7 3.0 Å, Structures of two intermediate filament-binding fragments of desmoplakin reveal a unique…
9A8U Integrative structure of the epithelial desmosomal outer plaque

Browse structure collections

About this viewer

MolViewer shows 1LM5 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.