3R6N: Desmoplakin

Crystal structure of a rigid four spectrin repeat fragment of the human desmoplakin plakin domain. Determined by X-ray diffraction at 2.95 Å resolution. Released 11 May 2011.

Method: X-ray diffraction
Resolution: 2.95 Å
Organism: Homo sapiens
Chains: 2
Atoms: 7,486
Mol. weight: 107.2 kDa
Ligands: DTT, D1D
Released: 11 May 2011

Explore 3R6N in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3R6N contains 33 α-helices and 14 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 16 helices, 7 β-strands

Element	Residues	Length	Sheet
α-helix	182-201	20
α-helix	205-207	3
α-helix	211-241	31
α-helix	245-294	50
α-helix	307-338	32
α-helix	344-402	59
α-helix	411-442	32
α-helix	449-451	3
α-helix	460-461	2
β-strand	462-465	4	1
β-strand	469-471	3	2
β-strand	474-476	3	2
β-strand	481-486	6	1
β-strand	492-496	5	1
β-strand	503-506	4	1
α-helix	507-509	3
β-strand	510-511	2	1
α-helix	513	1
α-helix	515	1
α-helix	517-561	45
α-helix	565-568	4
α-helix	576-594	19
α-helix	602-624	23

Chain B: 17 helices, 7 β-strands

Element	Residues	Length	Sheet
α-helix	184-202	19
α-helix	206-208	3
α-helix	211-239	29
α-helix	245-294	50
α-helix	305-338	34
α-helix	344-401	58
α-helix	411-442	32
α-helix	445-447	3
α-helix	449-451	3
α-helix	460-461	2
β-strand	462-465	4	3
β-strand	469-470	2	4
β-strand	475-476	2	4
β-strand	481-486	6	3
β-strand	492-496	5	3
β-strand	502-506	5	3
α-helix	507-509	3
β-strand	510-511	2	3
α-helix	513	1
α-helix	515	1
α-helix	517-561	45
α-helix	566-568	3
α-helix	575-594	20
α-helix	602-624	23

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Desmoplakin	A, B	protein	450	Homo sapiens	P15924 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>3R6N_1 Desmoplakin (chains A, B)
SGWDEFTKHVTSECLGWMRQQRAEMDMVAWGVDLASVEQHINSHRGIHNSIGDYRWQLDK
IKADLREKSAIYQLEEEYENLLKASFERMDHLRQLQNIIQATSREIMWINDCEEEELLYD
WSDKNTNIAQKQEAFSIRMSQLEVKEKELNKLKQESDQLVLNQHPASDKIEAYMDTLQTQ
WSWILQITKCIDVHLKENAAYFQFFEEAQSTEAYLKGLQDSIRKKYPCDKNMPLQHLLEQ
IKELEKEREKILEYKRQVQNLVNKSKKIVQLKPRNPDYRSNKPIILRALCDYKQDQKIVH
KGDECILKDNNERSKWYVTGPGGVDMLVPSVGLIIPPPNPLAVDLSCKIEQYYEAILALW
NQLYINMKSLVSWHYCMIDIEKIRAMTIAKLKTMRQEDYMKTIADLELHYQEFIRNSQGS
EMFGDDDKRKIQSQFTDAQKHYQTLVIQLP

Ligands and cofactors

ID	Name	Formula	Copies
DTT	2,3-dihydroxy-1,4-dithiobutane	C4 H10 O2 S2	2
D1D	(4S,5S)-1,2-dithiane-4,5-diol	C4 H8 O2 S2	2

Primary citation

Crystal structure of a rigid four-spectrin-repeat fragment of the human desmoplakin plakin domain. Choi, H.J., Weis, W.I. J Mol Biol (2011) 409:800-812. DOI 10.1016/j.jmb.2011.04.046 · PubMed

Other PDB entries of the same protein (UniProt P15924 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1LM5 1.8 Å, Structures of two intermediate filament-binding fragments of desmoplakin reveal a unique…
5DZZ 2.6 Å, Structural characterization of intermediate filaments binding domain of desmoplakin
1LM7 3.0 Å, Structures of two intermediate filament-binding fragments of desmoplakin reveal a unique…
9A8U Integrative structure of the epithelial desmosomal outer plaque

Browse structure collections

About this viewer

MolViewer shows 3R6N directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.