1LM7: Subdomain of Desmoplakin Carboxy-Terminal domain

Structures of two intermediate filament-binding fragments of desmoplakin reveal a unique repeat motif structure. Determined by X-ray diffraction at 3.0 Å resolution. Released 31 Jul 2002.

Method: X-ray diffraction
Resolution: 3.0 Å
Organism: Homo sapiens
Chains: 2
Atoms: 3,708
Mol. weight: 55.14 kDa
Released: 31 Jul 2002

Explore 1LM7 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1LM7 contains 27 α-helices and 28 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 13 helices, 14 β-strands

Element	Residues	Length	Sheet
β-strand	2210-2211	2	1
β-strand	2216-2217	2	1
α-helix	2219-2224	6
α-helix	2230-2237	8
α-helix	2246-2249	4
α-helix	2251-2254	4
β-strand	2260-2265	6	2
β-strand	2270-2273	4	2
α-helix	2274-2278	5
α-helix	2285-2296	12
β-strand	2301-2303	3	3
β-strand	2308-2310	3	3
α-helix	2312-2317	6
α-helix	2334-2337	4
β-strand	2339-2340	2	4
β-strand	2347-2348	2	4
α-helix	2350-2354	5
α-helix	2361-2372	12
β-strand	2377-2378	2	5
β-strand	2385-2386	2	5
α-helix	2388-2393	6
α-helix	2399-2406	8
β-strand	2414-2417	4	6
β-strand	2422-2424	3	6
α-helix	2426-2431	6
β-strand	2434	1	2
β-strand	2442-2446	5	2

Chain B: 14 helices, 14 β-strands

Element	Residues	Length	Sheet
β-strand	2210-2211	2	7
β-strand	2216-2217	2	7
α-helix	2219-2224	6
α-helix	2230-2234	5
α-helix	2246-2249	4
α-helix	2251-2254	4
β-strand	2260-2265	6	8
β-strand	2270-2272	3	8
α-helix	2274-2278	5
α-helix	2285-2296	12
β-strand	2301-2303	3	9
β-strand	2308-2310	3	9
α-helix	2312-2317	6
α-helix	2326-2329	4
α-helix	2334-2337	4
β-strand	2339-2340	2	10
β-strand	2347-2348	2	10
α-helix	2350-2354	5
α-helix	2361-2372	12
β-strand	2377-2379	3	11
β-strand	2384-2386	3	11
α-helix	2388-2393	6
α-helix	2399-2406	8
β-strand	2414-2417	4	12
β-strand	2422-2424	3	12
α-helix	2426-2431	6
β-strand	2434	1	8
β-strand	2442-2446	5	8

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
subdomain of Desmoplakin Carboxy-Terminal domain (DPCT)	A, B	protein	248	Homo sapiens	P15924 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>1LM7_1 subdomain of Desmoplakin Carboxy-Terminal domain (DPCT) (chains A, B)
SFQGIRQPVTVTELVDSGILRPSTVNELESGQISYDEVGERIKDFLQGSSCIAGIYNETT
KQKLGIYEAMKIGLVRPGTALELLEAQAATGFIVDPVSNLRLPVEEAYKRGLVGIEFKEK
LLSAERAVTGYNDPETGNIISLFQAMNKELIEKGHGIRLLEAQIATGGIIDPKESHRLPV
DIAYKRGYFNEELSEILSDPSDDTKGFFDPNTEENLTYLQLKERCIKDEETGLCLLPLKE
KKKQVQTS

Primary citation

Structures of two intermediate filament-binding fragments of desmoplakin reveal a unique repeat motif structure. Choi, H.J., Park-Snyder, S., Pascoe, L.T. et al. Nat Struct Biol (2002) 9:612-620. PubMed

Other PDB entries of the same protein (UniProt P15924 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1LM5 1.8 Å, Structures of two intermediate filament-binding fragments of desmoplakin reveal a unique…
5DZZ 2.6 Å, Structural characterization of intermediate filaments binding domain of desmoplakin
3R6N 2.95 Å, Crystal structure of a rigid four spectrin repeat fragment of the human desmoplakin…
9A8U Integrative structure of the epithelial desmosomal outer plaque

Browse structure collections

About this viewer

MolViewer shows 1LM7 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.