Structural characterization of intermediate filaments binding domain of desmoplakin. Determined by X-ray diffraction at 2.6 Å resolution. Released 23 Mar 2016.
Explore 5DZZ in 3D Show helices and sheets RCSB PDB PDBe
5DZZ contains 30 α-helices and 28 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 1963-1965 | 3 | |
| β-strand | 1967-1969 | 3 | 1 |
| β-strand | 1974-1976 | 3 | 1 |
| α-helix | 1977-1982 | 6 | |
| α-helix | 1988-1996 | 9 | |
| α-helix | 2001-2005 | 5 | |
| α-helix | 2009-2012 | 4 | |
| β-strand | 2018-2021 | 4 | 2 |
| β-strand | 2029 | 1 | 2 |
| α-helix | 2031-2036 | 6 | |
| α-helix | 2042-2055 | 14 | |
| β-strand | 2058-2060 | 3 | 3 |
| β-strand | 2065-2067 | 3 | 3 |
| α-helix | 2069-2074 | 6 | |
| α-helix | 2083-2094 | 12 | |
| β-strand | 2096-2097 | 2 | 4 |
| β-strand | 2104-2105 | 2 | 4 |
| α-helix | 2107-2112 | 6 | |
| α-helix | 2118-2129 | 12 | |
| β-strand | 2134-2136 | 3 | 5 |
| β-strand | 2141-2143 | 3 | 5 |
| α-helix | 2145-2150 | 6 | |
| α-helix | 2156-2161 | 6 | |
| β-strand | 2172-2173 | 2 | 6 |
| β-strand | 2180-2181 | 2 | 6 |
| α-helix | 2183-2187 | 5 | |
| β-strand | 2190-2192 | 3 | 2 |
| α-helix | 2193 | 1 | |
| β-strand | 2199-2201 | 3 | 2 |
| β-strand | 2209-2211 | 3 | 7 |
| β-strand | 2216-2218 | 3 | 7 |
| α-helix | 2219-2224 | 6 | |
| α-helix | 2230-2237 | 8 | |
| α-helix | 2243-2249 | 7 | |
| α-helix | 2251-2254 | 4 | |
| β-strand | 2260-2265 | 6 | 8 |
| β-strand | 2270-2272 | 3 | 8 |
| α-helix | 2274-2280 | 7 | |
| α-helix | 2285-2296 | 12 | |
| β-strand | 2301-2303 | 3 | 9 |
| β-strand | 2308-2310 | 3 | 9 |
| α-helix | 2312-2317 | 6 | |
| α-helix | 2326-2332 | 7 | |
| α-helix | 2334-2337 | 4 | |
| β-strand | 2339-2340 | 2 | 10 |
| β-strand | 2347-2348 | 2 | 10 |
| α-helix | 2350-2355 | 6 | |
| α-helix | 2361-2372 | 12 | |
| β-strand | 2377-2379 | 3 | 11 |
| β-strand | 2384-2386 | 3 | 11 |
| α-helix | 2387 | 1 | |
| α-helix | 2390-2394 | 5 | |
| α-helix | 2399-2406 | 8 | |
| β-strand | 2415-2417 | 3 | 12 |
| β-strand | 2422-2424 | 3 | 12 |
| α-helix | 2426-2430 | 5 | |
| β-strand | 2434-2435 | 2 | 8 |
| β-strand | 2442-2446 | 5 | 8 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Desmoplakin | A | protein | 494 | Homo sapiens | P15924 (AlphaFold model) |
>5DZZ_1 Desmoplakin (chains A) GAMGSTVDTSKLVFDGLRKKVTAMQLYECQLIDKTTLDKLLKGKKSVEEVASEIQPFLRG AGSIAGASASPKEKYSLVEAKRKKLISPESTVMLLEAQAATGGIIDPHRNEKLTVDSAIA RDLIDFDDRQQIYAAEKAITGFDDPFSGKTVSVSEAIKKNLIDRETGMRLLEAQIASGGV VDPVNSVFLPKDVALARGLIDRDLYRSLNDPRDSQKNFVDPVTKKKVSYVQLKERCRIEP HTGLLLLSVQKRSMSFQGIRQPVTVTELVDSGILRPSTVNELESGQISYDEVGERIKDFL QGSSCIAGIYNETTKQKLGIYEAMKIGLVRPGTALELLEAQAATGFIVDPVSNLRLPVEE AYKRGLVGIEFKEKLLSAERAVTGYNDPETGNIISLFQAMNKELIEKGHGIRLLEAQIAT GGIIDPKESHRLPVDIAYKRGYFNEELSEILSDPSDDTKGFFDPNTEENLTYLQLKERCI KDEETGLCLLPLKE
Structure of the Intermediate Filament-Binding Region of Desmoplakin. Kang, H., Weiss, T.M., Bang, I. et al. PLoS One (2016) 11:e0147641-e0147641. DOI 10.1371/journal.pone.0147641 · PubMed
Other PDB entries of the same protein (UniProt P15924 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 5DZZ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.