Human DNA Topoisomerase I (70 Kda) In Non-Covalent Complex With A 22 Base Pair DNA Duplex Containing an 8-oxoG Lesion. Determined by X-ray diffraction at 3.14 Å resolution. Released 16 Aug 2002.
Explore 1LPQ in 3D Show helices and sheets RCSB PDB PDBe
1LPQ contains 34 α-helices and 23 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 205-207 | 3 | |
| α-helix | 209-212 | 4 | |
| β-strand | 220-221 | 2 | 1 |
| β-strand | 226 | 1 | 2 |
| α-helix | 227-231 | 5 | |
| α-helix | 233-235 | 3 | |
| β-strand | 240-242 | 3 | 3 |
| β-strand | 245-247 | 3 | 3 |
| α-helix | 251-261 | 11 | |
| α-helix | 267-270 | 4 | |
| α-helix | 272-284 | 13 | |
| α-helix | 288-291 | 4 | |
| β-strand | 300-301 | 2 | 3 |
| α-helix | 303-316 | 14 | |
| α-helix | 321-337 | 17 | |
| β-strand | 340-343 | 4 | 1 |
| β-strand | 346-349 | 4 | 1 |
| β-strand | 350 | 1 | 4 |
| β-strand | 354 | 1 | 2 |
| α-helix | 355-358 | 4 | |
| β-strand | 359-360 | 2 | 5 |
| α-helix | 372 | 1 | |
| β-strand | 373-374 | 2 | 5 |
| α-helix | 375-377 | 3 | |
| β-strand | 383-384 | 2 | 6 |
| β-strand | 403-404 | 2 | 6 |
| β-strand | 416-417 | 2 | 7 |
| β-strand | 424-425 | 2 | 7 |
| β-strand | 429 | 1 | 4 |
| α-helix | 437-450 | 14 | |
| α-helix | 455-462 | 8 | |
| α-helix | 475-484 | 10 | |
| β-strand | 495 | 1 | 8 |
| β-strand | 498 | 1 | 8 |
| β-strand | 508 | 1 | 9 |
| α-helix | 509-511 | 3 | |
| β-strand | 512-517 | 6 | 10 |
| β-strand | 522-530 | 9 | 10 |
| α-helix | 532-534 | 3 | |
| β-strand | 536-542 | 7 | 10 |
| α-helix | 545-553 | 9 | |
| β-strand | 563 | 1 | 9 |
| α-helix | 570-580 | 11 | |
| α-helix | 586-605 | 20 | |
| α-helix | 612-622 | 11 | |
| α-helix | 625-627 | 3 | |
| α-helix | 648-652 | 5 | |
| α-helix | 653-662 | 10 | |
| α-helix | 667-672 | 6 | |
| α-helix | 680-682 | 3 | |
| α-helix | 684-687 | 4 | |
| α-helix | 689-699 | 11 | |
| α-helix | 702-707 | 6 | |
| α-helix | 726-735 | 10 | |
| α-helix | 740-743 | 4 | |
| α-helix | 746-751 | 6 | |
| α-helix | 753-757 | 5 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| 5'-D(*AP*AP*AP*AP*AP*GP*AP*CP*TP*TP*(8OG)P*GP*AP*AP*AP*AP*AP*TP*TP*TP*TP*T)-3' | B | DNA | 22 | ||
| 5'-d(*ap*ap*ap*ap*ap*tp*tp*tp*tp*tp*cp*cp*ap*ap*gp*tp*cp*tp*tp*tp*tp*t)-3' | C | DNA | 22 | ||
| DNA topoisomerase I | A | protein | 564 | Homo sapiens | P11387 (AlphaFold model) |
>1LPQ_1 5'-D(*AP*AP*AP*AP*AP*GP*AP*CP*TP*TP*(8OG)P*GP*AP*AP*AP*AP*AP*TP*TP*TP*TP*T)-3' (chains B) AAAAAGACTTGGAAAAATTTTT
>1LPQ_2 5'-D(*AP*AP*AP*AP*AP*TP*TP*TP*TP*TP*CP*CP*AP*AP*GP*TP*CP*TP*TP*TP*TP*T)-3' (chains C) AAAAATTTTTCCAAGTCTTTTT
>1LPQ_3 DNA topoisomerase I (chains A) KWKWWEEERYPEGIKWKFLEHKGPVFAPPYEPLPENVKFYYDGKVMKLSPKAEEVATFFA KMLDHEYTTKEIFRKNFFKDWRKEMTNEEKNIITNLSKCDFTQMSQYFKAQTEARKQMSK EEKLKIKEENEKLLKEYGFCIMDNHKERIANFKIEPPGLFRGRGNHPKMGMLKRRIMPED IIINCSKDAKVPSPPPGHKWKEVRHDNKVTWLVSWTENIQGSIKYIMLNPSSRIKGEKDW QKYETARRLKKCVDKIRNQYREDWKSKEMKVRQRAVALYFIDKLALRAGNEKEEGETADT VGCCSLRVEHINLHPELDGQEYVVEFDFLGKDSIRYYNKVPVEKRVFKNLQLFMENKQPE DDLFDRLNTGILNKHLQDLMEGLTAKVFRTYNASITLQQQLKELTAPDENIPAKILSYNR ANRAVAILCNHQRAPPKTFEKSMMNLQTKIDAKKEQLADARRDLKSAKADAKVMKDAKTK KVVESKKKAVQRLEEQLMKLEVQATDREENKQIALGTSKLNFLDPRITVAWCKKWGVPIE KIYNKTQREKFAWAIDMADEDYEF
8-Oxoguanine rearranges the active site of human topoisomerase I. Lesher, D.T., Pommier, Y., Stewart, L. et al. Proc Natl Acad Sci U S A (2002) 99:12102-12107. DOI 10.1073/pnas.192282699 · PubMed
Other PDB entries of the same protein (UniProt P11387 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 1LPQ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.