1LUQ: Full Matrix Error Analysis of Streptavidin

Full Matrix Error Analysis of Streptavidin. Determined by X-ray diffraction at 0.96 Å resolution. Released 9 Sept 2003.

Method: X-ray diffraction
Resolution: 0.96 Å
Organism: Streptomyces avidinii
Chains: 2
Atoms: 2,236
Mol. weight: 27.23 kDa
Ligands: BTN
Released: 9 Sept 2003

Explore 1LUQ in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1LUQ contains 4 α-helices and 16 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 2 helices, 8 β-strands

Element	Residues	Length	Sheet
β-strand	1019-1023	5	1
β-strand	1028-1033	6	1
β-strand	1038-1044	7	1
β-strand	1054-1060	7	1
β-strand	1071-1080	10	1
β-strand	1085-1097	13	1
β-strand	1103-1112	10	1
α-helix	1113	1
α-helix	1116-1121	6
β-strand	1123-1133	11	1

Chain B: 2 helices, 8 β-strands

Element	Residues	Length	Sheet
β-strand	2019-2023	5	2
β-strand	2028-2033	6	2
β-strand	2038-2044	7	2
β-strand	2053-2060	8	2
β-strand	2071-2080	10	2
β-strand	2085-2097	13	2
β-strand	2103-2112	10	2
α-helix	2113	1
α-helix	2116-2121	6
β-strand	2123-2131	9	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Streptavidin	A, B	protein	127	Streptomyces avidinii	P22629 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>1LUQ_1 Streptavidin (chains A, B)
AEAGITGTWYNQLGSTFIVTAGADGALTGTYEAAVGNAESRYVLTGRYDSAPATDGSGTA
LGWTVAWKNNYRNAHSATTWSGQYVGGAEARINTQWLLTSGTTEANAWKSTLVGHDTFTK
VKPSAAS

Ligands and cofactors

ID	Name	Formula	Copies
BTN	Biotin	C10 H16 N2 O3 S	2

Water and common crystallization additives (MPD, GOL) are not listed.

Primary citation

Full Matrix Error Analysis of Streptavidin. Merritt, E.A., Le Trong, I. To be published.

Other PDB entries of the same protein (UniProt P22629 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2F01 0.85 Å, Epi-biotin complex with core streptavidin
9PUA 0.94 Å, L-Biotin-streptavidin binding
3RY2 0.95 Å, Wild-type core streptavidin-biotin complex at atomic resolution
9PUB 0.95 Å, Biotin-streptavidin binding
2GH7 1.0 Å, Epi-biotin complex with core streptavidin
3WYQ 1.0 Å, Crystal structure of the low-immunogenic core streptavidin mutant LISA-314…
4GDA 1.0 Å, Circular Permuted Streptavidin A50/N49
6T2L 1.0 Å, Streptavidin variants harbouring an artificial organocatalyst based cofactor
3RY1 1.03 Å, Wild-type core streptavidin at atomic resolution
5N8B 1.03 Å, Crystal structure of streptavidin with peptide afpdylaeyhgg
5N8J 1.05 Å, CRYSTAL STRUCTURE OF STREPTAVIDIN WITH PEPTIDE D-amino acid containing peptide…
4CPE 1.06 Å, Wild-type streptavidin in complex with love-hate ligand 1 (LH1)

Browse structure collections

About this viewer

MolViewer shows 1LUQ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.