1LXF: Regulatory N-domain of Human Cardiac Troponin C

Structure of the Regulatory N-domain of Human Cardiac Troponin C in Complex with Human Cardiac Troponin-I(147-163) and Bepridil. Determined by solution NMR. Released 11 Dec 2002.

Method: Solution NMR
Organism: Homo sapiens
Chains: 2
Atoms: 850
Mol. weight: 12.28 kDa
Ligands: BEP, CA
Released: 11 Dec 2002

Explore 1LXF in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1LXF contains 6 α-helices and 2 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain C: 5 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	3-11	9
α-helix	14-27	14
β-strand	36	1	1
α-helix	38-47	10
α-helix	54-64	11
β-strand	72	1	1
α-helix	74-85	12

Chain I: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	151-156	6

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Troponin C, slow skeletal and cardiac muscles	C	protein	89	Homo sapiens	P63316 (AlphaFold model)
Troponin I, cardiac muscle	I	protein	17		P19429 (AlphaFold model)

Sequence of entity 1 (C), FASTA

>1LXF_1 TROPONIN C, SLOW SKELETAL AND CARDIAC MUSCLES (chains C)
MDDIYKAAVEQLTEEQKNEFKAAFDIFVLGAEDGCISTKELGKVMRMLGQNPTPEELQEM
IDEVDEDGSGTVDFDEFLVMMVRCMKDDS

Sequence of entity 2 (I), FASTA

>1LXF_2 Troponin I, cardiac muscle (chains I)
RISADAMMQALLGARAK

Ligands and cofactors

ID	Name	Formula	Copies
BEP	1-isobutoxy-2-pyrrolidino-3[N-benzylanilino] propane	C24 H34 N2 O	1
CA	Calcium ion	Ca	1

Primary citation

Structure of the regulatory N-domain of human cardiac troponin C in complex with human cardiac troponin I147-163 and bepridil. Wang, X., Li, M.X., Sykes, B.D. J Biol Chem (2002) 277:31124-31133. DOI 10.1074/jbc.M203896200 · PubMed

Other PDB entries of the same protein (UniProt P63316 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3SD6 1.37 Å, Crystal structure of the amino-terminal domain of human cardiac troponin C in complex…
4GJE 1.6 Å, Crystal structure of the refolded amino-terminal domain of human cardiac troponin C in…
3SWB 1.67 Å, Crystal structure of the amino-terminal domain of human cardiac troponin C in complex…
7SC2 1.81 Å, Crystal structure of the N-domain of cardiac muscle troponin C tethered to the switch…
4GJF 1.9 Å, Crystal structure of the amino-terminal domain of human cardiac troponin C mutant L29Q…
4GJG 2.0 Å, Crystal structure of the amino-terminal domain of human cardiac troponin C mutant…
4Y99 2.0 Å, Core domain of human cardiac troponin
1WRK 2.15 Å, Crystal structure of the N-terminal domain of human cardiac troponin C in complex with…
3RV5 2.2 Å, Crystal structure of human cardiac troponin C regulatory domain in complex with cadmium…
7SC3 2.23 Å, Crystal structure of the N-domain of cardiac muscle troponin C tethered to the switch…
1WRL 2.6 Å, Crystal structure of the N-terminal domain of human cardiac troponin C in complex with…
1J1D 2.61 Å, Crystal structure of the 46kDa domain of human cardiac troponin in the Ca2+ saturated form

Browse structure collections

About this viewer

MolViewer shows 1LXF directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.