1SQ0: PDB entry 1SQ0

Crystal Structure of the Complex of the Wild-type Von Willebrand Factor A1 domain and Glycoprotein Ib alpha at 2.6 Angstrom Resolution. Determined by X-ray diffraction at 2.6 Å resolution. Released 13 Apr 2004.

Method: X-ray diffraction
Resolution: 2.6 Å
Organism: Homo sapiens
Chains: 2
Atoms: 3,982
Mol. weight: 56.55 kDa
Released: 13 Apr 2004

Explore 1SQ0 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1SQ0 contains 17 α-helices and 28 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 11 helices, 10 β-strands

Element	Residues	Length	Sheet
β-strand	511	1	1
β-strand	513-520	8	2
β-strand	522	1	3
α-helix	527-543	17
β-strand	551-558	8	2
β-strand	562-566	5	2
α-helix	574-583	10
α-helix	584-586	3
β-strand	589	1	3
α-helix	594-600	7
α-helix	601-605	5
β-strand	615-622	8	2
α-helix	628-630	3
α-helix	634-643	10
β-strand	646-653	8	2
α-helix	659-668	10
β-strand	675-677	3	2
α-helix	680-682	3
α-helix	687-695	9
α-helix	699	1
β-strand	700	1	1

Chain B: 6 helices, 18 β-strands

Element	Residues	Length	Sheet
β-strand	5-9	5	2
β-strand	12-16	5	2
α-helix	25-26	2
β-strand	35-37	3	2
β-strand	45-47	3	4
α-helix	48-51	4
β-strand	59-61	3	2
β-strand	69-71	3	4
β-strand	81-83	3	2
β-strand	104-106	3	2
β-strand	128-130	3	2
β-strand	152-154	3	2
β-strand	176-178	3	2
β-strand	199-201	3	2
β-strand	207	1	5
α-helix	211-213	3
α-helix	214-222	9
β-strand	227-232	6	2
β-strand	237-241	5	2
α-helix	243-245	3
β-strand	247	1	6
β-strand	248	1	5
β-strand	255	1	6
α-helix	256-258	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Von Willebrand factor (vWF) [Contains: Von Willebrand antigen II]	A	protein	214	Homo sapiens	P04275 (AlphaFold model)
Platelet glycoprotein Ib alpha chain (Glycoprotein Ibalpha) (GP-Ib alpha) (GPIbA) (GPIb-alpha)…	B	protein	288	Homo sapiens	P07359 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1SQ0_1 Von Willebrand factor (vWF) [Contains: Von Willebrand antigen II] (chains A)
MEDISEPPLHDFYCSRLLDLVFLLDGSSRLSEAEFEVLKAFVVDMMERLRISQKWVRVAV
VEYHDGSHAYIGLKDRKRPSELRRIASQVKYAGSQVASTSEVLKYTLFQIFSKIDRPEAS
RIALLLMASQEPQRMSRNFVRYVQGLKKKKVIVIPVGIGPHANLKQIRLIEKQAPENKAF
VLSSVDELEQQRDEIVSYLCDLAPEAPPPTLPPH

Sequence of entity 2 (B), FASTA

>1SQ0_2 Platelet glycoprotein Ib alpha chain (Glycoprotein Ibalpha) (GP-Ib alpha) (GPIbA) (GPIb-alpha) (CD42B-alpha) (CD42B) [Contains: Glycocalicin] (chains B)
HPICEVSKVASHLEVNCDKRDLTALPPDLPKDTTILHLSENLLYTFSLATLMPYTRLTQL
NLDRCELTKLQVDGTLPVLGTLDLSHNQLQSLPLLGQTLPALTVLDVSFNRLTSLPLGAL
RGLGELQELYLKGNELKTLPPGLLTPTPKLEKLSLANNDLTELPAGLLNGLENLDTLLLQ
ENSLYTIPKGFFGSHLLPFAFLHGNPWLCNCEILYFRRWLQDNAENVYVWKQGVDVKAMT
SNVASVQCDNSDKFPVYKYPGKGCPTLGDEGDTDLYDYYPEEDTEGDK

Primary citation

Crystal structure of the wild-type von Willebrand factor A1-glycoprotein Ibalpha complex reveals conformation differences with a complex bearing von Willebrand disease mutations. Dumas, J.J., Kumar, R., McDonagh, T. et al. J Biol Chem (2004) 279:23327-23334. DOI 10.1074/jbc.M401659200 · PubMed

Other PDB entries of the same protein (UniProt P04275 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5BV8 1.59 Å, G1324S mutation in von Willebrand Factor A1 domain
7EOW 1.6 Å, High-resolution structure of vWF A1 domain in complex with caplacizumab, the first…
3ZQK 1.7 Å, Von Willebrand Factor A2 domain with calcium
1ATZ 1.8 Å, Human von willebrand factor A3 domain
1IJB 1.8 Å, The von Willebrand Factor mutant (I546V) A1 domain
2ADF 1.9 Å, Crystal Structure and Paratope Determination of 82D6A3, an Antithrombotic Antibody…
3GXB 1.9 Å, Crystal structure of VWF A2 domain
3PPV 1.9 Å, Crystal structure of an engineered VWF A2 domain (N1493C and C1670S)
3PPW 1.9 Å, Crystal structure of the D1596A mutant of an engineered VWF A2 domain (N1493C and C1670S)
3PPX 1.91 Å, Crystal structure of the N1602A mutant of an engineered VWF A2 domain (N1493C and C1670S)
1FNS 2.0 Å, Crystal structure of the von willebrand factor (VWF) A1 domain I546V mutant in complex…
3PPY 2.0 Å, Crystal structure of the D1596A/N1602A double mutant of an engineered VWF A2 domain…

Browse more

1SQ0 is part of these collections:

Blood clotting

About this viewer

MolViewer shows 1SQ0 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.