Crystal structure of the complex of Glycoprotein Ib alpha and the von Willebrand Factor A1 Domain. Determined by X-ray diffraction at 3.1 Å resolution. Released 28 Aug 2002.
Explore 1M10 in 3D Show helices and sheets RCSB PDB PDBe
1M10 contains 15 α-helices and 29 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 511 | 1 | 1 |
| β-strand | 513-520 | 8 | 2 |
| β-strand | 522 | 1 | 3 |
| α-helix | 527-542 | 16 | |
| β-strand | 546-547 | 2 | 2 |
| β-strand | 551-559 | 9 | 2 |
| β-strand | 561-564 | 4 | 2 |
| α-helix | 574-582 | 9 | |
| β-strand | 589 | 1 | 3 |
| α-helix | 594-600 | 7 | |
| α-helix | 601-605 | 5 | |
| β-strand | 615-621 | 7 | 2 |
| α-helix | 628-633 | 6 | |
| α-helix | 634-642 | 9 | |
| β-strand | 646-650 | 5 | 2 |
| β-strand | 651-653 | 3 | 4 |
| α-helix | 659-666 | 8 | |
| β-strand | 675-677 | 3 | 4 |
| α-helix | 680-682 | 3 | |
| α-helix | 683-695 | 13 | |
| α-helix | 699 | 1 | |
| β-strand | 700 | 1 | 1 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 5-9 | 5 | 5 |
| β-strand | 12-16 | 5 | 5 |
| β-strand | 35-37 | 3 | 5 |
| β-strand | 45-47 | 3 | 6 |
| α-helix | 48-51 | 4 | |
| β-strand | 59-61 | 3 | 5 |
| β-strand | 69-71 | 3 | 6 |
| β-strand | 81-83 | 3 | 5 |
| β-strand | 104-106 | 3 | 5 |
| β-strand | 128-130 | 3 | 5 |
| β-strand | 152-154 | 3 | 5 |
| β-strand | 176-178 | 3 | 5 |
| β-strand | 199-201 | 3 | 5 |
| α-helix | 214-221 | 8 | |
| α-helix | 224-226 | 3 | |
| β-strand | 227 | 1 | 5 |
| β-strand | 228-232 | 5 | 2 |
| β-strand | 237-241 | 5 | 2 |
| α-helix | 243-245 | 3 | |
| β-strand | 247 | 1 | 7 |
| β-strand | 255 | 1 | 7 |
| α-helix | 256-258 | 3 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| von Willebrand Factor | A | protein | 208 | Homo sapiens | P04275 (AlphaFold model) |
| Glycoprotein Ib alpha | B | protein | 290 | Homo sapiens | P07359 (AlphaFold model) |
>1M10_1 von Willebrand Factor (chains A) DISEPPLHDFYCSRLLDLVFLLDGSSRLSEAEFEVLKAFVVDMMEQLRISQKWVRVAVVE YHDGSHAYIGLKDRKRPSELRRIASQVKYAGSQVASTSEVLKYTLFQIFSKIDRPEASRI ALLLMASQEPQRMSRNFVRYVQGLKKKKVIVIPVGIGPHANLKQIRLIEKQAPENKAFVL SSVDELEQQRDEIVSYLCDLAPEAPPPT
>1M10_2 Glycoprotein Ib alpha (chains B) HPICEVSKVASHLEVNCDKRQLTALPPDLPKDTTILHLSENLLYTFSLATLMPYTRLTQL NLDRCELTKLQVDGTLPVLGTLDLSHNQLQSLPLLGQTLPALTVLDVSFNRLTSLPLGAL RGLGELQELYLKGNELKTLPPGLLTPTPKLEKLSLANNQLTELPAGLLNGLENLDTLLLQ ENSLYTIPKGFFGSHLLPFAFLHGNPWLCNCEILYFRRWLQDNAENVYVWKQGVDVKAVT SNVASVQCDNSDKFPVYKYPGKGCPTLGDEGDTDLYDYYPEEDTEGDKVR
Structures of glycoprotein Ibalpha and its complex with von Willebrand factor A1 domain. Huizinga, E.G., Tsuji, S., Romijn, R.A. et al. Science (2002) 297:1176-1179. DOI 10.1126/science.107355 · PubMed
Other PDB entries of the same protein (UniProt P04275 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 1M10 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.