1M4J: A6 gene product

Crystal structure of the N-terminal adf-H domain of mouse twinfilin isoform-1. Determined by X-ray diffraction at 1.6 Å resolution. Released 13 Nov 2002.

Method: X-ray diffraction
Resolution: 1.6 Å
Organism: Mus musculus
Chains: 2
Atoms: 2,273
Mol. weight: 32.59 kDa
Released: 13 Nov 2002

Explore 1M4J in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1M4J contains 16 α-helices and 12 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 8 helices, 6 β-strands

Element	Residues	Length	Sheet
β-strand	9	1	1
α-helix	11-19	9
α-helix	20-24	5
β-strand	27-32	6	1
β-strand	37-43	7	1
α-helix	49-57	9
α-helix	58-60	3
β-strand	67-77	11	1
β-strand	80-88	9	1
α-helix	95-112	18
α-helix	114-116	3
β-strand	117-123	7	1
α-helix	126-129	4
α-helix	131-138	8

Chain B: 8 helices, 6 β-strands

Element	Residues	Length	Sheet
β-strand	8-9	2	2
α-helix	11-19	9
α-helix	20-24	5
β-strand	27-32	6	2
β-strand	36-43	8	2
α-helix	49-56	8
α-helix	58-60	3
β-strand	67-77	11	2
β-strand	80-88	9	2
α-helix	95-112	18
α-helix	114-116	3
β-strand	117-123	7	2
α-helix	126-129	4
α-helix	131-138	8

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
A6 gene product	A, B	protein	142	Mus musculus	Q91YR1 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>1M4J_1 A6 gene product (chains A, B)
MSHQTGIQASEDVKEIFARARNGKYRLLKISIENEQLVVGSCSPPSDSWEQDYDSFVLPL
LEDKQPCYVLFRLDSQNAQGYEWIFIAWSPDHSHVRQKMLYAATRATLKKEFGGGHIKDE
VFGTVKEDVSLHGYKKYLLSQS

Primary citation

Structural Conservation Between the Actin Monomer-binding Sites of Twinfilin and Actin-depolymerizing Factor (ADF)/Cofilin. Paavilainen, V.O., Merckel, M.C., Falck, S. et al. J Biol Chem (2002) 277:43089-43095. DOI 10.1074/jbc.M208225200 · PubMed

Other PDB entries of the same protein (UniProt Q91YR1 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7DS6 1.69 Å, Crystal structure of actin capping protein in complex with twinflin-1/CD2AP CPI chimera…
7DS4 1.85 Å, Crystal structure of actin capping protein in complex with twinflin-1 C-terminus tail…
6RSW 1.95 Å, HFD domain of mouse CAP1 bound to the pointed end of G-actin
7DS2 1.95 Å, Crystal structure of actin capping protein in complex with twinflin-1 C-terminus tail
7DS8 1.95 Å, Crystal structure of actin capping protein in complex with twinflin-1/CD2AP CPI chimera…
7DSB 2.44 Å, Crystal structure of actin capping protein in complex with V-1 and twinfilin C-terminal…
3DAW 2.55 Å, Structure of the actin-depolymerizing factor homology domain in complex with actin
6YP9 2.56 Å, Rabbit muscle actin in complex with ADF-H and ATP-ATTO-488
2D8B Solution structure of the second tandem cofilin-domain of mouse twinfilin
2HD7 Solution structure of C-teminal domain of twinfilin-1.

Browse structure collections

About this viewer

MolViewer shows 1M4J directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.