Crystal structure of human tgf-beta type II receptor ligand binding domain. Determined by X-ray diffraction at 1.05 Å resolution. Released 11 Sept 2002.
Explore 1M9Z in 3D Show helices and sheets RCSB PDB PDBe
1M9Z contains 1 α-helix and 12 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 27-29 | 3 | 1 |
| β-strand | 32-35 | 4 | 2 |
| β-strand | 43-45 | 3 | 3 |
| β-strand | 51-53 | 3 | 1 |
| β-strand | 60-67 | 8 | 2 |
| β-strand | 72-79 | 8 | 2 |
| β-strand | 85 | 1 | 4 |
| β-strand | 88 | 1 | 4 |
| β-strand | 98-99 | 2 | 3 |
| β-strand | 101-103 | 3 | 2 |
| β-strand | 109-115 | 7 | 2 |
| α-helix | 120-122 | 3 | |
| β-strand | 123-125 | 3 | 3 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Tgf-beta receptor type II | A | protein | 111 | Homo sapiens | P37173 (AlphaFold model) |
>1M9Z_1 TGF-BETA RECEPTOR TYPE II (chains A) ALCKFCDVRFSTCDNQKSCMSNCSITSICEKPQEVCVAVWRKNDENITLETVCHDPKLPY HDFILEDAASPTCIMKEKKKPGETFFMCSCSSDECNDNIIFSEEYNTSNPD
THE 1.1A CRYSTAL STRUCTURE OF HUMAN TGF-BETA TYPE II RECEPTOR LIGAND BINDING DOMAIN. Boesen, C.C., Radaev, S., Motyka, S.A. et al. Structure (2002) 10:913-919. DOI 10.1016/S0969-2126(02)00780-3 · PubMed
Other PDB entries of the same protein (UniProt P37173 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 1M9Z directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.