8G4K: Complex of TbRII mini protein binder

Complex of TbRII mini protein binder bound to the TbRII ECD. Determined by X-ray diffraction at 1.24 Å resolution. Released 14 Aug 2024.

Method: X-ray diffraction
Resolution: 1.24 Å
Organisms: synthetic construct, Homo sapiens
Chains: 2
Atoms: 1,942
Mol. weight: 24.36 kDa
Released: 14 Aug 2024

Explore 8G4K in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

8G4K contains 7 α-helices and 12 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 5 helices, 0 β-strands

Element	Residues	Length
α-helix	24-37	14
α-helix	40-59	20
α-helix	63-80	18
α-helix	83-101	19
α-helix	106-119	14

Chain B: 2 helices, 12 β-strands

Element	Residues	Length	Sheet
α-helix	47-49	3
β-strand	50-52	3	1
β-strand	55-58	4	2
β-strand	66-68	3	3
β-strand	74-76	3	1
β-strand	83-91	9	2
β-strand	94-102	9	2
β-strand	108	1	4
β-strand	111	1	4
β-strand	121-122	2	3
β-strand	124-126	3	2
β-strand	132-138	7	2
α-helix	143-145	3
β-strand	146-148	3	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
5HCS_TGFBR2_1	A	protein	104	synthetic construct
TGF-beta receptor type-2	B	protein	111	Homo sapiens	P37173 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>8G4K_1 5HCS_TGFBR2_1 (chains A)
SGSGLKELLKELNKAIASGDTETVRRILEELLELLKEAFEKGDYDLAISIASMAVKAASY
IGDTETLKELLEILKKIKEKLKKEGDEAALKAVERNIKVVEKVA

Sequence of entity 2 (B), FASTA

>8G4K_2 TGF-beta receptor type-2 (chains B)
MKFPQLCKFCDVRFSTCDNQKSCMSNCSITSICEKPQEVCVAVWRKNDENITLETVCHDP
KLPYHDFILEDAASPKCIMKEKKKPGETFFMCSCSSDECNDNIIFSEEYNT

Primary citation

Design of high-affinity binders to immune modulating receptors for cancer immunotherapy. Yang, W., Hicks, D.R., Ghosh, A. et al. Nat Commun (2025) 16:2001-2001. DOI 10.1038/s41467-025-57192-z · PubMed

Other PDB entries of the same protein (UniProt P37173 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1M9Z 1.05 Å, Crystal structure of human tgf-beta type II receptor ligand binding domain
4XJJ 1.4 Å, Extracellular domain of type II Transforming Growth Factor Beta receptor in complex with…
9E9G 1.4 Å, Heligmosomoides polygyrus TGF-beta Mimic 6 Domain 3 (TGM6-D3) Bound to Human TGF-beta…
4P7U 1.5 Å, Extracellular domain of type II Transforming Growth Factor Beta receptor in complex with…
5QIN 1.57 Å, Tgf-beta receptor type 2 kinase domain in complex with N-…
5E8V 1.69 Å, Tgf-beta receptor type 2 kinase domain (E431A,R433A,E485A,K488A,R493A,R495A)
5TX4 1.88 Å, Derivative of mouse TGF-beta2, with a deletion of residues 52-71 and K25R, R26K, L51R,…
5E8Y 2.05 Å, Tgf-beta receptor type 2 kinase domain (E431A,R433A,E485A,K488A,R493A,R495A) in complex…
5E92 2.08 Å, Tgf-beta receptor type 2 kinase domain (E431A,R433A,E485A,K488A,R493A,R495A) in complex…
8YGZ 2.1 Å, The Crystal Structure of TGF beta R2 kinase domain from Biortus.
1KTZ 2.15 Å, Crystal Structure of the Human TGF-beta Type II Receptor Extracellular Domain in Complex…
7DV6 2.39 Å, Discovery of Functionally Selective Transforming Growth Factor beta Type II Receptor…

Browse structure collections

About this viewer

MolViewer shows 8G4K directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.