X-ray structures of the mgadp, mgatpgammas, and mgamppnp complexes of the dictyostelium discoideum myosin motor domain. Determined by X-ray diffraction at 2.1 Å resolution. Released 3 Dec 1997.
Explore 1MMA in 3D Show helices and sheets RCSB PDB PDBe
1MMA contains 35 α-helices and 27 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 10-15 | 6 | |
| β-strand | 34-37 | 4 | 1 |
| β-strand | 48-56 | 9 | 1 |
| β-strand | 59-63 | 5 | 1 |
| β-strand | 70 | 1 | 1 |
| β-strand | 73 | 1 | 1 |
| α-helix | 74-76 | 3 | |
| β-strand | 79 | 1 | 1 |
| α-helix | 80-82 | 3 | |
| α-helix | 83-85 | 3 | |
| β-strand | 90 | 1 | 2 |
| α-helix | 91-93 | 3 | |
| α-helix | 99-111 | 13 | |
| β-strand | 116-119 | 4 | 2 |
| β-strand | 122-126 | 5 | 2 |
| α-helix | 137-143 | 7 | |
| α-helix | 148-150 | 3 | |
| α-helix | 155-169 | 15 | |
| β-strand | 173-178 | 6 | 2 |
| α-helix | 185-200 | 16 | |
| α-helix | 210-226 | 17 | |
| β-strand | 227-228 | 2 | 3 |
| β-strand | 236-237 | 2 | 3 |
| β-strand | 240-247 | 8 | 2 |
| β-strand | 253-261 | 9 | 2 |
| α-helix | 265-268 | 4 | |
| α-helix | 279-287 | 9 | |
| α-helix | 290-295 | 6 | |
| α-helix | 301-303 | 3 | |
| α-helix | 320-334 | 15 | |
| α-helix | 338-356 | 19 | |
| β-strand | 360-361 | 2 | 4 |
| β-strand | 367-368 | 2 | 4 |
| α-helix | 373-382 | 10 | |
| α-helix | 386-394 | 9 | |
| β-strand | 397-399 | 3 | 5 |
| β-strand | 404-406 | 3 | 5 |
| α-helix | 411-441 | 31 | |
| β-strand | 448-454 | 7 | 2 |
| α-helix | 466-492 | 27 | |
| α-helix | 507-510 | 4 | |
| α-helix | 511-518 | 8 | |
| β-strand | 520 | 1 | 6 |
| β-strand | 523 | 1 | 6 |
| α-helix | 525-534 | 10 | |
| α-helix | 540-551 | 12 | |
| β-strand | 558-559 | 2 | 7 |
| β-strand | 567-572 | 6 | 7 |
| β-strand | 575-580 | 6 | 7 |
| α-helix | 584-589 | 6 | |
| α-helix | 594-601 | 8 | |
| α-helix | 606-613 | 8 | |
| α-helix | 615-618 | 4 | |
| α-helix | 627-629 | 3 | |
| α-helix | 630-646 | 17 | |
| β-strand | 649-656 | 8 | 2 |
| α-helix | 669-678 | 10 | |
| α-helix | 681-690 | 10 | |
| α-helix | 725-729 | 5 | |
| β-strand | 734 | 1 | 8 |
| β-strand | 737 | 1 | 8 |
| α-helix | 750-752 | 3 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Myosin | A | protein | 762 | Dictyostelium discoideum | P08799 (AlphaFold model) |
>1MMA_1 MYOSIN (chains A) MNPIHDRTSDYHKYLKVKQGDSDLFKLTVSDKRYIWYNPDPKERDSYECGEIVSETSDSF TFKTSDGQDRQVKKDDANQRNPIKFDGVEDMSELSYLNEPAVFHNLRVRYNQDLIYTYSG LFLVAVNPFKRIPIYTQEMVDIFKGRRRNEVAPHIFAISDVAYRSMLDDRQNQSLLITGE SGAGKTENTKKVIQYLASVAGRNQANGSGVLEQQILQANPILEAFGNAKTTRNNNSSRFG KFIEIQFNNAGFISGASIQSYLLEKSRVVFQSETERNYHIFYQLLAGATAEEKKALHLAG PESFNYLNQSGCVDIKGVSDSEEFKITRQAMDIVGFSQEEQMSIFKIIAGILHLGNIKFE KGAGEGAVLKDKTALNAASTVFGVNPSVLEKALMEPRILAGRDLVAQHLNVEKSSSSRDA LVKALYGRLFLWLVKKINNVLCQERKAYFIGVLDISGFEIFKVNSFEQLCINYTNEKLQQ FFNHHMFKLEQEEYLKEKINWTFIDFGLDSQATIDLIDGRQPPGILALLDEQSVFPNATD NTLITKLHSHFSKKNAKYEEPRFSKTEFGVTHYAGQVMYEIQDWLEKNKDPLQQDLELCF KDSSDNVVTKLFNDPNIASRAKKGANFITVAAQYKEQLASLMATLETTNPHFVRCIIPNN KQLPAKLEDKVVLDQLRCNGVLEGIRITRKGFPNRIIYADFVKRYYLLAPNVPRDAEDSQ KATDAVLKHLNIDPEQFRFGITKIFFRAGQLARIEEARELPN
X-ray structures of the MgADP, MgATPgammaS, and MgAMPPNP complexes of the Dictyostelium discoideum myosin motor domain. Gulick, A.M., Bauer, C.B., Thoden, J.B. et al. Biochemistry (1997) 36:11619-11628. DOI 10.1021/bi9712596 · PubMed
Other PDB entries of the same protein (UniProt P08799 (AlphaFold model), which also has an AlphaFold model), best resolution first:
1MMA is part of these collections:
MolViewer shows 1MMA directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.