1MMS: Ribosomal PROTEIN L11-RNA complex

Crystal structure of the ribosomal PROTEIN L11-RNA complex. Determined by X-ray diffraction at 2.57 Å resolution. Released 17 Apr 2000.

Method: X-ray diffraction
Resolution: 2.57 Å
Organism: Thermotoga maritima
Chains: 4
Atoms: 4,173
Mol. weight: 70.43 kDa
Ligands: MMC, MG, CD
Released: 17 Apr 2000

Explore 1MMS in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1MMS contains 12 α-helices and 7 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 7 helices, 5 β-strands

Element	Residues	Length	Sheet
β-strand	9-14	6	1
α-helix	26-29	4
α-helix	35-45	11
β-strand	53-60	8	1
β-strand	66-70	5	1
α-helix	72-74	3
α-helix	75-83	9
β-strand	98-100	3	2
α-helix	102-112	11
α-helix	113-115	3
α-helix	121-132	12
β-strand	137-139	3	2

Chain B: 5 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	72-74	3
α-helix	75-83	9
β-strand	98-100	3	3
α-helix	102-112	11
α-helix	113-115	3
α-helix	121-133	13
β-strand	137-139	3	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
23S ribosomal RNA	C, D	RNA	58
Protein (ribosomal protein L11)	A, B	protein	140	Thermotoga maritima	P29395 (AlphaFold model)

Sequence of entity 1 (C, D), FASTA

>1MMS_1 23S RIBOSOMAL RNA (chains C, D)
GCUGGGAUGUUGGCUUAGAAGCAGCCAUCAUUUAAAGAGUGCGUAACAGCUCACCAGC

Sequence of entity 2 (A, B), FASTA

>1MMS_2 PROTEIN (RIBOSOMAL PROTEIN L11) (chains A, B)
AKKVAAQIKLQLPAGKATPAPPVGPALGQHGVNIMEFCKRFNAETADKAGMILPVVITVY
EDKSFTFIIKTPPASFLLKKAAGIEKGSSEPKRKIVGKVTRKQIEEIAKTKMPDLNANSL
EAAMKIIEGTAKSMGIEVVD

Ligands and cofactors

ID	Name	Formula	Copies
MMC	Methyl mercury ion	C H3 Hg	8
MG	Magnesium ion	Mg	19
CD	Cadmium ion	Cd	8

Primary citation

A detailed view of a ribosomal active site: the structure of the L11-RNA complex. Wimberly, B.T., Guymon, R., McCutcheon, J.P. et al. Cell (1999) 97:491-502. DOI 10.1016/S0092-8674(00)80759-X · PubMed

Other PDB entries of the same protein (UniProt P29395 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4V42 5.5 Å, Crystal structure of the ribosome at 5.5 A resolution.
4V4R 5.9 Å, Crystal structure of the whole ribosomal complex.
4V4T 6.46 Å, Crystal structure of the whole ribosomal complex with a stop codon in the A-site.
4V4S 6.76 Å, Crystal structure of the whole ribosomal complex.
487D 7.5 Å, Seven ribosomal proteins fitted to a CRYO-electron microscopic map of the large 50S…
1R2W 9.0 Å, Coordinates of L11 with 58nts of 23S rRNA fitted into the cryo-EM map of the 70S ribosome
1R2X 9.0 Å, Coordinates of L11 with 58nts of 23S rRNA fitted into the cryo-EM map of EF-Tu ternary…
1PN7 10.8 Å, Coordinates of S12, L11 proteins and P-tRNA, from the 70S X-ray structure aligned to the…
1PN8 10.8 Å, Coordinates of S12, L11 proteins and E-site tRNA from 70S crystal structure separately…
2BCW 11.2 Å, Coordinates of the N-terminal domain of ribosomal protein L11,C-terminal domain of…
1EG0 11.5 Å, Fitting of components with known structure into an 11.5 a cryo-EM map of the e.coli 70S…
1MVR 12.8 Å, Decoding Center & Peptidyl transferase center from the X-ray structure of the Thermus…

Browse structure collections

About this viewer

MolViewer shows 1MMS directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.