1MOE: Anti-CEA mAb T84.66

The three-dimensional structure of an engineered scFv T84.66 dimer or diabody in VL to VH linkage. Determined by X-ray diffraction at 2.6 Å resolution. Released 18 Mar 2003.

Method: X-ray diffraction
Resolution: 2.6 Å
Organism: Mus musculus
Chains: 2
Atoms: 3,722
Mol. weight: 51.92 kDa
Released: 18 Mar 2003

Explore 1MOE in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1MOE contains 13 α-helices and 46 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 6 helices, 23 β-strands

Element	Residues	Length	Sheet
β-strand	4-7	4	1
β-strand	10-13	4	2
β-strand	19-25	7	1
β-strand	30-31	2	3
β-strand	34-35	2	3
β-strand	37-42	6	2
β-strand	49-53	5	2
β-strand	57-58	2	2
α-helix	59	1
β-strand	66-71	6	1
β-strand	74-79	6	1
α-helix	84-86	3
β-strand	88-94	7	2
β-strand	102	1	2
β-strand	106-110	5	2
β-strand	122-125	4	4
α-helix	126-128	3
β-strand	129-131	3	5
β-strand	137-144	8	4
α-helix	148-150	3
β-strand	153-158	6	5
β-strand	165-171	7	5
β-strand	176-179	4	5
α-helix	181-183	3
β-strand	187-192	6	4
β-strand	197-202	6	4
α-helix	207-209	3
β-strand	211-217	7	5
β-strand	234-238	5	5

Chain B: 7 helices, 23 β-strands

Element	Residues	Length	Sheet
β-strand	4-7	4	6
β-strand	10-13	4	7
β-strand	19-25	7	6
β-strand	30-31	2	8
β-strand	34-35	2	8
β-strand	37-42	6	7
β-strand	48-53	6	7
β-strand	57-58	2	7
α-helix	59	1
β-strand	66-70	5	6
β-strand	74-79	6	6
α-helix	84-86	3
β-strand	88-94	7	7
α-helix	100	1
β-strand	101-102	2	7
β-strand	106-110	5	7
β-strand	122-125	4	9
α-helix	126-128	3
β-strand	129-131	3	10
β-strand	137-144	8	9
α-helix	148-150	3
β-strand	153-158	6	10
β-strand	164-170	7	10
β-strand	177-179	3	10
α-helix	181-183	3
β-strand	187-192	6	9
β-strand	197-202	6	9
α-helix	207-209	3
β-strand	211-217	7	10
β-strand	234-238	5	10

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
anti-CEA mAb T84.66	A, B	protein	240	Mus musculus	P01660 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>1MOE_1 anti-CEA mAb T84.66 (chains A, B)
DIVLTQSPASLAVSLGQRATMSCRAGESVDIFGVGFLHWYQQKPGQPPKLLIYRASNLES
GIPVRFSGTGSRTDFTLIIDPVEADDVATYYCQQTNEDPYTFGGGTKLEIKGGGSGGGGE
VQLQQSGAELVEPGASVKLSCTASGFNIKDTYMHWVKQRPEQGLEWIGRIDPANGNSKYV
PKFQGKATITADTSSNTAYLQLTSLTSEDTAVYYCAPFGYYVSDYAMAYWGQGTSVTVSS

Primary citation

The Crystal Structure of an Anti-CEA scFv Diabody Assembled from T84.66 scFvs in VL-to-VH Orientation: Implications for Diabody Flexibility. Carmichael, J.A., Power, B.E., Garrett, T.P. et al. J Mol Biol (2003) 326:341-351. DOI 10.1016/S0022-2836(02)01428-6 · PubMed

Other PDB entries of the same protein (UniProt P01660 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1J05 1.5 Å, The crystal structure of anti-carcinoembryonic antigen monoclonal antibody T84.66 Fv…
1I8K 1.8 Å, Crystal structure of dsfv MR1 in complex with the peptide antigen of the mutant…
2VL5 2.1 Å, Structure of anti-collagen type II FAb CIIC1
4NJA 2.2 Å, Crystal structure of Fab 6C8 in complex with MPTS
1EJO 2.3 Å, FAB fragment of neutralising monoclonal antibody 4C4 complexed with G-H loop from fmdv.
1I8I 2.4 Å, Crystal structure of dsfv MR1 in complex with the peptide antigen of the mutant…
2R29 3.0 Å, Neutralization of dengue virus by a serotype cross-reactive antibody elucidated by…
3BSZ 3.38 Å, Crystal structure of the transthyretin-retinol binding protein-Fab complex
1QFW 3.5 Å, Ternary complex of human chorionic gonadotropin with fv anti alpha subunit and fv anti…
2R69 3.8 Å, Crystal structure of Fab 1A1D-2 complexed with E-DIII of Dengue virus at 3.8 angstrom…
2R6P 24.0 Å, Fit of E protein and Fab 1A1D-2 into 24 angstrom resolution cryoEM map of Fab complexed…

Browse structure collections

About this viewer

MolViewer shows 1MOE directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.