1EJO: IGG2A monoclonal antibody

FAB fragment of neutralising monoclonal antibody 4C4 complexed with G-H loop from fmdv. Determined by X-ray diffraction at 2.3 Å resolution. Released 22 Mar 2000.

Method: X-ray diffraction
Resolution: 2.3 Å
Organism: Mus musculus
Chains: 3
Atoms: 3,520
Mol. weight: 48.95 kDa
Released: 22 Mar 2000

Explore 1EJO in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1EJO contains 15 α-helices and 46 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain H: 6 helices, 23 β-strands

Element	Residues	Length	Sheet
β-strand	2503-2506	4	7
β-strand	2510-2511	2	8
β-strand	2517-2523	7	7
α-helix	2528-2530	3
β-strand	2532-2538	7	9
β-strand	2544-2550	7	9
β-strand	2557-2558	2	9
β-strand	2564	1	7
β-strand	2567-2572	6	7
β-strand	2577-2582	6	7
α-helix	2587-2589	3
β-strand	2591-2599	9	9
β-strand	2608-2609	2	9
β-strand	2613-2615	3	9
β-strand	2616-2617	2	8
α-helix	2621-2622	2
β-strand	2623	1	10
β-strand	2626-2630	5	11
β-strand	2642-2651	10	11
β-strand	2652	1	10
β-strand	2659-2660	2	12
α-helix	2661-2663	3
β-strand	2669-2671	3	11
α-helix	2672-2674	3
β-strand	2675-2676	2	11
β-strand	2681-2689	9	11
β-strand	2700-2705	6	12
α-helix	2706-2708	3
β-strand	2710-2715	6	12

Chain L: 9 helices, 23 β-strands

Element	Residues	Length	Sheet
β-strand	2004-2006	3	1
β-strand	2010-2013	4	2
β-strand	2019-2025	7	1
β-strand	2030-2031	2	3
β-strand	2034-2035	2	3
β-strand	2037-2042	6	2
β-strand	2049-2053	5	2
β-strand	2057-2058	2	2
α-helix	2059	1
β-strand	2066-2071	6	1
β-strand	2074-2079	6	1
α-helix	2082-2083	2
α-helix	2084-2086	3
β-strand	2088-2094	7	2
α-helix	2100	1
β-strand	2101-2102	2	2
β-strand	2106-2110	5	2
α-helix	2112-2114	3
β-strand	2115	1	4
β-strand	2118-2122	5	5
α-helix	2123-2125	3
α-helix	2126-2130	5
β-strand	2133-2143	11	5
β-strand	2144	1	4
β-strand	2149-2154	6	6
β-strand	2157	1	6
β-strand	2163-2167	5	5
α-helix	2168-2171	4
β-strand	2177-2186	10	5
α-helix	2187-2192	6
β-strand	2195-2202	8	6
β-strand	2205-2214	10	6

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
IGG2A monoclonal antibody (light chain)	L	protein	216	Mus musculus	P01660 (AlphaFold model)
IGG2A monoclonal antibody (heavy chain)	H	protein	220	Mus musculus	Q6PF95 (AlphaFold model)
Fmdv peptide	P	protein	15		P15072 (AlphaFold model)

Sequence of entity 1 (L), FASTA

>1EJO_1 IGG2A MONOCLONAL ANTIBODY (LIGHT CHAIN) (chains L)
DIVLTQSPASLAVSLGQRATISCRASESVDSYGNSFMHWYQQKPGQPPKLLIYRASNLES
GIPARFSGSGSRTDFTLTINPVEADDVATYYCQQSNEDPLTFGAGTKLELKRADAAPTVS
IFPPSSEQLTSGGASVVCFLNNFYPKDINVRWKIDGSERQNGVLNSWTDQDSKDSTYSMS
STLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRA

Sequence of entity 2 (H), FASTA

>1EJO_2 IGG2A MONOCLONAL ANTIBODY (HEAVY CHAIN) (chains H)
EQMLVESGGDLVKPGGSLKLSCAASGFTFSSYTMSWVRQTPEKRLEWVATISSGGAYTYY
PDSVKGRFTISDDNAESTLYLQMSSLRSEDTAMYYCVRRAFDSDVGFASWGHRTLVTVSA
AKTTAPSVYPLAPVCGGTTGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSD
LYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEPR

Sequence of entity 3 (P), FASTA

>1EJO_3 FMDV PEPTIDE (chains P)
YTTSTRGDLAHVTTT

Primary citation

A multiply substituted G-H loop from foot-and-mouth disease virus in complex with a neutralizing antibody: a role for water molecules. Ochoa, W.F., Kalko, S.G., Mateu, M.G. et al. J Gen Virol (2000) 81:1495-1505. PubMed

Other PDB entries of the same protein (UniProt P01660 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1J05 1.5 Å, The crystal structure of anti-carcinoembryonic antigen monoclonal antibody T84.66 Fv…
1I8K 1.8 Å, Crystal structure of dsfv MR1 in complex with the peptide antigen of the mutant…
2VL5 2.1 Å, Structure of anti-collagen type II FAb CIIC1
4NJA 2.2 Å, Crystal structure of Fab 6C8 in complex with MPTS
1I8I 2.4 Å, Crystal structure of dsfv MR1 in complex with the peptide antigen of the mutant…
1MOE 2.6 Å, The three-dimensional structure of an engineered scFv T84.66 dimer or diabody in VL to…
2R29 3.0 Å, Neutralization of dengue virus by a serotype cross-reactive antibody elucidated by…
3BSZ 3.38 Å, Crystal structure of the transthyretin-retinol binding protein-Fab complex
1QFW 3.5 Å, Ternary complex of human chorionic gonadotropin with fv anti alpha subunit and fv anti…
2R69 3.8 Å, Crystal structure of Fab 1A1D-2 complexed with E-DIII of Dengue virus at 3.8 angstrom…
2R6P 24.0 Å, Fit of E protein and Fab 1A1D-2 into 24 angstrom resolution cryoEM map of Fab complexed…

Browse structure collections

About this viewer

MolViewer shows 1EJO directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.