1MXL: Cardiac troponin C-troponin I complex

Structure of cardiac troponin C-troponin I complex. Determined by solution NMR. Released 6 Jul 1999.

Method: Solution NMR
Organism: Homo sapiens
Chains: 2
Atoms: 823
Mol. weight: 11.92 kDa
Ligands: CA
Released: 6 Jul 1999

Explore 1MXL in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1MXL contains 6 α-helices and 2 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain C: 5 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	4-10	7
α-helix	14-27	14
β-strand	36	1	1
α-helix	41-48	8
α-helix	54-62	9
β-strand	72	1	1
α-helix	74-82	9

Chain I: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	4-10	7

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Protein (troponin C)	C	protein	89	Homo sapiens	P63316 (AlphaFold model)
Protein (troponin I)	I	protein	17		P19429 (AlphaFold model)

Sequence of entity 1 (C), FASTA

>1MXL_1 PROTEIN (TROPONIN C) (chains C)
MDDIYKAAVEQLTEEQKNEFKAAFDIFVLGAEDGCISTKELGKVMRMLGQNPTPEELQEM
IDEVDEDGSGTVDFDEFLVMMVRCMKDDS

Sequence of entity 2 (I), FASTA

>1MXL_2 PROTEIN (TROPONIN I) (chains I)
RISADAMMQALLGARAK

Ligands and cofactors

ID	Name	Formula	Copies
CA	Calcium ion	Ca	1

Primary citation

Binding of cardiac troponin-I147-163 induces a structural opening in human cardiac troponin-C. Li, M.X., Spyracopoulos, L., Sykes, B.D. Biochemistry (1999) 38:8289-8298. DOI 10.1021/bi9901679 · PubMed

Other PDB entries of the same protein (UniProt P63316 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3SD6 1.37 Å, Crystal structure of the amino-terminal domain of human cardiac troponin C in complex…
4GJE 1.6 Å, Crystal structure of the refolded amino-terminal domain of human cardiac troponin C in…
3SWB 1.67 Å, Crystal structure of the amino-terminal domain of human cardiac troponin C in complex…
7SC2 1.81 Å, Crystal structure of the N-domain of cardiac muscle troponin C tethered to the switch…
4GJF 1.9 Å, Crystal structure of the amino-terminal domain of human cardiac troponin C mutant L29Q…
4GJG 2.0 Å, Crystal structure of the amino-terminal domain of human cardiac troponin C mutant…
4Y99 2.0 Å, Core domain of human cardiac troponin
1WRK 2.15 Å, Crystal structure of the N-terminal domain of human cardiac troponin C in complex with…
3RV5 2.2 Å, Crystal structure of human cardiac troponin C regulatory domain in complex with cadmium…
7SC3 2.23 Å, Crystal structure of the N-domain of cardiac muscle troponin C tethered to the switch…
1WRL 2.6 Å, Crystal structure of the N-terminal domain of human cardiac troponin C in complex with…
1J1D 2.61 Å, Crystal structure of the 46kDa domain of human cardiac troponin in the Ca2+ saturated form

Browse structure collections

About this viewer

MolViewer shows 1MXL directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.