1MZ8: Nuclease domain of COLE7/IM7

Crystal structures of the nuclease domain of COLE7/IM7 in complex with a phosphate ion and a zinc ion. Determined by X-ray diffraction at 2.0 Å resolution. Released 23 Dec 2002.

Method: X-ray diffraction
Resolution: 2.0 Å
Organism: Escherichia coli
Chains: 4
Atoms: 4,081
Mol. weight: 50.26 kDa
Ligands: PO4, ZN
Released: 23 Dec 2002

Explore 1MZ8 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1MZ8 contains 28 α-helices and 26 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains A and C: 5 helices, 0 β-strands

Element	Residues	Length
α-helix	7-9	3
α-helix	12-26	15
α-helix	32-45	14
α-helix	52-55	4
α-helix	65-78	14

Chains B and D: 9 helices, 13 β-strands

Element	Residues	Length	Sheet
β-strand	451-452	2	1
β-strand	454	1	2
β-strand	458	1	3
β-strand	474-475	2	4
α-helix	476	1
β-strand	477	1	3
α-helix	478-484	7
β-strand	488-489	2	1
α-helix	492-505	14
α-helix	507-510	4
α-helix	515-522	8
α-helix	525-527	3
β-strand	528	1	5
α-helix	531-533	3
β-strand	535	1	6
β-strand	538	1	6
β-strand	540	1	5
β-strand	542-545	4	4
α-helix	549-551	3
β-strand	557	1	2
β-strand	561-564	4	4
α-helix	566-573	8

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Colicin E7 immunity protein	A, C	protein	87	Escherichia coli	Q03708 (AlphaFold model)
Colicin E7	B, D	protein	131	Escherichia coli	Q47112 (AlphaFold model)

Sequence of entity 1 (A, C), FASTA

>1MZ8_1 Colicin E7 immunity protein (chains A, C)
MELKNSISDYTEAEFVQLLKEIEKENVAATDDVLDVLLEHFVKITEHPDGTDLIYYPSDN
RDDSPEGIVKEIKEWRAANGKPGFKQG

Sequence of entity 2 (B, D), FASTA

>1MZ8_2 Colicin E7 (chains B, D)
KRNKPGKATGKGKPVNNKWLNNAGKDLGSPVPDRIANKLRDKEFKSFDDFRKKFWEEVSK
DPELSKQFSRNNNDRMKVGKAPKTRTQDVSGKRTSFELHHEKPISQNGGVYDMDNISVVT
PKRHIDIHRGK

Ligands and cofactors

ID	Name	Formula	Copies
PO4	Phosphate ion	O4 P	2
ZN	Zinc ion	Zn	2

Primary citation

Metal ions and phosphate binding in the H-N-H motif: crystal structures of the nuclease domain of ColE7/Im7 in complex with a phosphate ion and different divalent metal ions. Sui, M.J., Tsai, L.C., Hsia, K.C. et al. Protein Sci (2002) 11:2947-2957. DOI 10.1110/ps.0220602 · PubMed

Other PDB entries of the same protein (UniProt Q03708 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5WNW 1.79 Å, Chaperone Spy bound to Im7 6-45 ensemble
1CEI 1.8 Å, Structure determination of the colicin E7 immunity protein (IMME7) that binds…
1UNK 1.8 Å, Structure of colicin E7 immunity protein
2JB0 1.91 Å, Crystal structure of the mutant H573A of the nuclease domain of COLE7 in complex with IM7
1AYI 2.0 Å, Colicin E7 immunity protein IM7
1ZNV 2.0 Å, How a His-metal finger endonuclease ColE7 binds and cleaves DNA with a transition metal…
2ERH 2.0 Å, Crystal Structure of the E7_G/Im7_G complex; a designed interface between the colicin E7…
2JAZ 2.03 Å, Crystal structure of the mutant N560D of the nuclease domain of COLE7 in complex with IM7
1UJZ 2.1 Å, Crystal structure of the E7_C/Im7_C complex; a computationally designed interface…
2JBG 2.2 Å, crystal structure of the mutant N560A of the nuclease domain of ColE7 in complex with Im7
7CEI 2.3 Å, The endonuclease domain of colicin E7 in complex with its inhibitor IM7 protein
4F37 2.57 Å, Structure of the tethered N-terminus of Alzheimer's disease A peptide

Browse structure collections

About this viewer

MolViewer shows 1MZ8 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.