1N04: Diferric chicken serum transferrin

Diferric chicken serum transferrin at 2.8 A resolution. Determined by X-ray diffraction at 2.8 Å resolution. Released 30 Sept 2003.

Method: X-ray diffraction
Resolution: 2.8 Å
Organism: Gallus gallus
Chains: 1
Atoms: 5,307
Mol. weight: 76.32 kDa
Ligands: CO3, FE, FUL
Released: 30 Sept 2003

Explore 1N04 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1N04 contains 32 α-helices and 30 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 32 helices, 30 β-strands

Element	Residues	Length	Sheet
β-strand	6-11	6	1
α-helix	14-26	13
β-strand	33-38	6	1
α-helix	42-50	9
β-strand	56	1	1
β-strand	58-59	2	2
α-helix	61-67	7
β-strand	75-82	8	2
β-strand	91-99	9	3
α-helix	106-108	3
β-strand	114-116	3	3
α-helix	122-126	5
α-helix	127-134	8
α-helix	148-155	8
β-strand	159-160	2	3
α-helix	168-171	4
α-helix	190-199	10
β-strand	206-209	4	3
α-helix	218-223	6
β-strand	224-227	4	3
β-strand	233-234	2	3
α-helix	236-241	6
β-strand	245-248	4	3
α-helix	249-250	2
β-strand	251-254	4	2
α-helix	261-274	14
α-helix	293-295	3
β-strand	304-309	6	2
α-helix	316-320	5
α-helix	322-330	9
β-strand	342	1	4
β-strand	344	1	4
β-strand	345-350	6	5
α-helix	352-364	13
β-strand	369-374	6	5
α-helix	377-386	10
β-strand	391	1	5
β-strand	392-394	3	6
α-helix	396-404	9
β-strand	408-414	7	6
β-strand	430-438	9	7
β-strand	452-454	3	7
α-helix	461-465	5
α-helix	466-474	9
α-helix	481-483	3
β-strand	486-488	3	7
α-helix	497-500	4
α-helix	524-532	9
β-strand	537-541	5	7
α-helix	544-548	5
α-helix	558-560	3
β-strand	566-569	4	7
β-strand	575-576	2	7
β-strand	587-590	4	7
α-helix	591-592	2
β-strand	593-596	4	6
α-helix	598-600	3
α-helix	601-615	15
β-strand	643-646	4	6
α-helix	653-657	5
α-helix	659-668	10
α-helix	675-683	9

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
serum transferrin	A	protein	686	Gallus gallus	P02789 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1N04_1 serum transferrin (chains A)
APPKSVIRWCTISSPEEKKCNNLRDLTQQERISLTCVQKATYLDCIKAIANNEADAISLD
GGQAFEAGLAPYKLKPIAAEVYEHTEGSTTSYYAVAVVKKGTEFTVNDLQGKTSCHTGLG
RSAGWNIPIGTLLHRGAIEWEGIESGSVEQAVAKFFSASCVPGATIEQKLCRQCKGDPKT
KCARNAPYSGYSGAFHCLKDGKGDVAFVKHTTVNENAPDQKDEYELLCLDGSRQPVDNYK
TCNWARVAAHAVVARDDNKVEDIWSFLSKAQSDFGVDTKSDFHLFGPPGKKDPVLKDLLF
KDSAIMLKRVPSLMDSQLYLGFEYYSAIQSMRKDQLTPSPRENRIQWCAVGKDEKSKCDR
WSVVSNGDVECTVVDETKDCIIKIMKGEADAVALDGGLVYTAGVCGLVPVMAERYDDESQ
CSKTDERPASYFAVAVARKDSNVNWNNLKGKKSCHTAVGRTAGWVIPMGLIHNRTGTCNF
DEYFSEGCAPGSPPNSRLCQLCQGSGGIPPEKCVASSHEKYFGYTGALRCLVEKGDVAFI
QHSTVEENTGGKNKADWAKNLQMDDFELLCTDGRRANVMDYRECNLAEVPTHAVVVRPEK
ANKIRDLLERQEKRFGVNGSEKSKFMMFESQNKDLLFKDLTKCLFKVREGTTYKEFLGDK
FYTVISSLKTCNPSDILQMCSFLEGK

Ligands and cofactors

ID	Name	Formula	Copies
CO3	Carbonate ion	C O3	2
FE	FE (III) ion	Fe	2
FUL	beta-L-fucopyranose	C6 H12 O5	1

Primary citation

Structure of diferric hen serum transferrin at 2.8 A resolution. Guha Thakurta, P., Choudhury, D., Dasgupta, R. et al. Acta Crystallogr D Biol Crystallogr (2003) 59:1773-1781. DOI 10.1107/S0907444903016652 · PubMed

Other PDB entries of the same protein (UniProt P02789 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8X3H 0.93 Å, Crystal structure of iron-bound recombinant ovotransferrin N-lobe at 0.93 angstrom…
1IEJ 1.65 Å, Ovotransferrin, N-terminal lobe, holo form, at 1.65 a resolution
1TFA 1.9 Å, Ovotransferrin, N-terminal lobe, apo form
1NFT 2.1 Å, Ovotransferrin, N-terminal lobe, iron loaded open form
2D3I 2.15 Å, Crystal Structure of Aluminum-Bound Ovotransferrin at 2.15 Angstrom Resolution
1IQ7 2.3 Å, Ovotransferrin, C-Terminal Lobe, Apo Form
1NNT 2.3 Å, Structural evidence for a PH-sensitive di-lysine trigger in the hen ovotransferrin…
1OVT 2.4 Å, Refined crystallographic structure of hen ovotransferrin at 2.4 Å resolution
1AIV 3.0 Å, Apo ovotransferrin
8FEI 3.0 Å, CryoEM structure of Conalbumin from chicken egg white (sigma-Cas 1391-06-6)
1D9K 3.2 Å, Crystal structure of complex between D10 TCR and pmhc I-ak/ca
1RYX 3.5 Å, Crystal structure of hen serum transferrin in apo- form

Browse structure collections

About this viewer

MolViewer shows 1N04 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.