1N6J: Myocyte-specific enhancer factor 2B

Structural basis of sequence-specific recruitment of histone deacetylases by Myocyte Enhancer Factor-2. Determined by X-ray diffraction at 2.2 Å resolution. Released 11 Nov 2003.

Method: X-ray diffraction
Resolution: 2.2 Å
Organism: Homo sapiens
Chains: 5
Atoms: 2,501
Mol. weight: 34.21 kDa
Released: 11 Nov 2003

Explore 1N6J in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1N6J contains 8 α-helices and 6 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 3 β-strands

Element	Residues	Length	Sheet
α-helix	14-39	26
β-strand	42-48	7	1
β-strand	54-58	5	1
α-helix	62-70	9
β-strand	77-80	4	1
α-helix	81-93	13

Chain B: 3 helices, 3 β-strands

Element	Residues	Length	Sheet
α-helix	14-39	26
β-strand	42-48	7	1
β-strand	54-58	5	1
α-helix	62-70	9
β-strand	77-80	4	1
α-helix	81-89	9

Chain G: 2 helices, 0 β-strands

Element	Residues	Length	Sheet
α-helix	105-107	3
α-helix	108-119	12

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
5'-d(apgpcptpaptptptpaptpapapgpc)-3'	C	DNA	14
5'-d(gpcptptpaptpapapaptpapgpcpt)-3'	D	DNA	14
Myocyte-specific enhancer factor 2B	A, B	protein	93	Homo sapiens	Q02080 (AlphaFold model)
Calcineurin-binding protein Cabin 1	G	protein	35	Homo sapiens	Q9Y6J0 (AlphaFold model)

Sequence of entity 1 (C), FASTA

>1N6J_1 5'-D(*AP*GP*CP*TP*AP*TP*TP*TP*AP*TP*AP*AP*GP*C)-3' (chains C)
AGCTATTTATAAGC

Sequence of entity 2 (D), FASTA

>1N6J_2 5'-D(*GP*CP*TP*TP*AP*TP*AP*AP*AP*TP*AP*GP*CP*T)-3' (chains D)
GCTTATAAATAGCT

Sequence of entity 3 (A, B), FASTA

>1N6J_3 Myocyte-specific enhancer factor 2B (chains A, B)
GRKKIQISRILDQRNRQVTFTKRKFGLMKKAYELSVLCDCEIALIIFNSANRLFQYASTD
MDRVLLKYTEYSEPHESRTNTDILETLKRRGIG

Sequence of entity 4 (G), FASTA

>1N6J_4 Calcineurin-binding protein Cabin 1 (chains G)
TLLSPKGSISEETKQKLKSAILSAQSAANVRKESL

Primary citation

Sequence-specific recruitment of transcriptional co-repressor Cabin1 by myocyte enhancer factor-2. Han, A., Pan, F., Stroud, J.C. et al. Nature (2003) 422:730-734. DOI 10.1038/nature01555 · PubMed

Other PDB entries of the same protein (UniProt Q02080 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6WC2 2.1 Å, Crystal Structure of a Ternary MEF2 Chimera/NKX2-5/myocardin enhancer DNA Complex
6BYY 2.3 Å, MEF2 CHIMERA/DNA Complex
6C9L 2.3 Å, MEF2B Apo Protein Structure
1TQE 2.7 Å, Mechanism of recruitment of class II histone deacetylases by myocyte enhancer factor-2
6WC5 2.9 Å, Crystal Structure of a Ternary MEF2B/NKX2-5/myocardin enhancer DNA Complex
6BZ1 2.97 Å, MEF2 Chimera D83V mutant/DNA complex

Browse structure collections

About this viewer

MolViewer shows 1N6J directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.