NMR structure of the interferon-binding ectodomain of the human interferon receptor. Determined by solution NMR. Released 15 Jul 2003.
Explore 1N6U in 3D Show helices and sheets RCSB PDB PDBe
1N6U contains 5 α-helices and 21 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 13 | 1 | 1 |
| α-helix | 14-15 | 2 | |
| β-strand | 16-19 | 4 | 2 |
| β-strand | 22-25 | 4 | 2 |
| β-strand | 28 | 1 | 1 |
| β-strand | 39-45 | 7 | 3 |
| β-strand | 48-54 | 7 | 3 |
| α-helix | 56-58 | 3 | |
| β-strand | 61 | 1 | 3 |
| α-helix | 65 | 1 | |
| β-strand | 66-68 | 3 | 2 |
| β-strand | 78-85 | 8 | 3 |
| β-strand | 86-87 | 2 | 4 |
| β-strand | 90-91 | 2 | 4 |
| β-strand | 95-100 | 6 | 3 |
| α-helix | 101-104 | 4 | |
| β-strand | 107 | 1 | 2 |
| β-strand | 111-116 | 6 | 5 |
| β-strand | 121-126 | 6 | 5 |
| α-helix | 132-134 | 3 | |
| β-strand | 140-147 | 8 | 6 |
| β-strand | 150 | 1 | 6 |
| β-strand | 153 | 1 | 6 |
| β-strand | 165-168 | 4 | 5 |
| β-strand | 179-186 | 8 | 6 |
| β-strand | 200-201 | 2 | 6 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Interferon-alpha/beta receptor beta chain | A | protein | 212 | Homo sapiens | P48551 (AlphaFold model) |
>1N6U_1 Interferon-alpha/beta receptor beta chain (chains A) SYDSPDYTDESCTFKISLRNFRSILSWELKNHSIVPTHYTLLYTIMSKPEDLKVVKNCAN TTRSFCDLTDEWRSTHEAYVTVLEGFSGNTTLFSCSHNFWLAIDMSFEPPEFEIVGFTNH INVMVKFPSIVEEELQFDLSLVIEEQSEGIVKKHKPEIKGNMSGNFTYIIDKLIPNTNYC VSVYLEHSDEQAVIKSPLKCTLLPPGQESEFS
The human type I interferon receptor. NMR structure reveals the molecular basis of ligand binding. Chill, J.H., Quadt, S.R., Levy, R. et al. Structure (2003) 11:791-802. DOI 10.1016/S0969-2126(03)00120-5 · PubMed
Other PDB entries of the same protein (UniProt P48551 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 1N6U directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.