1N6V: Interferon-alpha/beta receptor beta chain

Average structure of the interferon-binding ectodomain of the human type I interferon receptor. Determined by solution NMR. Released 15 Jul 2003.

Method: Solution NMR
Organism: Homo sapiens
Chains: 1
Atoms: 1,710
Mol. weight: 24.32 kDa
Released: 15 Jul 2003

Explore 1N6V in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1N6V contains 2 α-helices and 19 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 2 helices, 19 β-strands

Element	Residues	Length	Sheet
β-strand	13-18	6	1
β-strand	23-28	6	1
β-strand	39-45	7	2
β-strand	48-54	7	2
β-strand	61	1	2
β-strand	66-68	3	1
β-strand	78-85	8	2
β-strand	86-87	2	3
β-strand	90-91	2	3
β-strand	95-100	6	2
α-helix	101-104	4
β-strand	107	1	1
β-strand	111-117	7	4
β-strand	120-126	7	4
α-helix	132-134	3
β-strand	140-147	8	5
β-strand	150-154	5	5
β-strand	165	1	4
β-strand	168	1	4
β-strand	179-186	8	5
β-strand	199-201	3	5

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Interferon-alpha/beta receptor beta chain	A	protein	212	Homo sapiens	P48551 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1N6V_1 Interferon-alpha/beta receptor beta chain (chains A)
SYDSPDYTDESCTFKISLRNFRSILSWELKNHSIVPTHYTLLYTIMSKPEDLKVVKNCAN
TTRSFCDLTDEWRSTHEAYVTVLEGFSGNTTLFSCSHNFWLAIDMSFEPPEFEIVGFTNH
INVMVKFPSIVEEELQFDLSLVIEEQSEGIVKKHKPEIKGNMSGNFTYIIDKLIPNTNYC
VSVYLEHSDEQAVIKSPLKCTLLPPGQESEFS

Primary citation

The human type I interferon receptor. NMR structure reveals the molecular basis of ligand binding. Chill, J.H., Quadt, S.R., Levy, R. et al. Structure (2003) 11:791-802. DOI 10.1016/S0969-2126(03)00120-5 · PubMed

Other PDB entries of the same protein (UniProt P48551 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3S9D 2.0 Å, binary complex between IFNa2 and IFNAR2
3S8W 2.6 Å, D2 domain of human IFNAR2
3SE4 3.5 Å, human IFNw-IFNAR ternary complex
3SE3 4.0 Å, human IFNa2-IFNAR ternary complex
1N6U NMR structure of the interferon-binding ectodomain of the human interferon receptor
2HYM NMR based Docking Model of the Complex between the Human Type I Interferon Receptor and…
2KZ1 Inter-molecular interactions in a 44 kDa interferon-receptor complex detected by…
2LAG Structure of the 44 kDa complex of interferon-alpha2 with the extracellular part of…

Browse structure collections

About this viewer

MolViewer shows 1N6V directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.