Integrin alpha M I domain. Determined by X-ray diffraction at 1.5 Å resolution. Released 20 May 2003.
Explore 1NA5 in 3D Show helices and sheets RCSB PDB PDBe
1NA5 contains 14 α-helices and 8 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 133-140 | 8 | 1 |
| α-helix | 147-164 | 18 | |
| β-strand | 169-176 | 8 | 1 |
| β-strand | 180-184 | 5 | 1 |
| α-helix | 186-191 | 6 | |
| α-helix | 195-199 | 5 | |
| β-strand | 209 | 1 | 2 |
| α-helix | 211-217 | 7 | |
| α-helix | 218-222 | 5 | |
| α-helix | 225-227 | 3 | |
| α-helix | 229-230 | 2 | |
| β-strand | 234-241 | 8 | 1 |
| β-strand | 246 | 1 | 2 |
| α-helix | 252-261 | 10 | |
| β-strand | 264-271 | 8 | 1 |
| α-helix | 273-275 | 3 | |
| α-helix | 282-287 | 6 | |
| α-helix | 289 | 1 | |
| α-helix | 292-294 | 3 | |
| β-strand | 296-299 | 4 | 1 |
| α-helix | 302-308 | 7 | |
| α-helix | 309-317 | 9 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Integrin alpha-M | A | protein | 197 | Homo sapiens | P11215 (AlphaFold model) |
>1NA5_1 Integrin alpha-M (chains A) CPQEDSDIAFLIDGSGSIIPHDFRRMKEFVSTVMEQLKKSKTLFSLMQYSEEFRIHFTFK EFQNNPNPRSLVKPITQLLGRTHTATGIRKVVRELFNITNGARKNAFKILVVITDGEKFG DPLGYEDVIPEADREGVIRYVIGVGDAFRSEKSRQELNTIASKPPRDHVFQVNNFEALKT IQNQLREKIFAIGSPGI
Engineered allosteric mutants of the integrin alphaMbeta2 I domain: structural and functional studies. McCleverty, C.J., Liddington, R.C. Biochem J (2003) 372:121-127. DOI 10.1042/BJ20021273 · PubMed
Other PDB entries of the same protein (UniProt P11215 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 1NA5 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.