8CE6: Human Cd11b I domain in P212121 space group

Crystal structure of human Cd11b I domain in P212121 space group. Determined by X-ray diffraction at 1.58 Å resolution. Released 22 Mar 2023.

Method: X-ray diffraction
Resolution: 1.58 Å
Organism: Homo sapiens
Chains: 1
Atoms: 1,788
Mol. weight: 25.99 kDa
Released: 22 Mar 2023

Explore 8CE6 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

8CE6 contains 14 α-helices and 10 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 14 helices, 10 β-strands

Element	Residues	Length	Sheet
β-strand	-3--2	2	1
β-strand	1-8	8	2
α-helix	15-32	18
β-strand	37-44	8	2
β-strand	48-52	5	2
α-helix	54-59	6
α-helix	63-67	5
β-strand	77	1	3
α-helix	79-85	7
α-helix	86-90	5
α-helix	93-95	3
β-strand	102-109	8	2
β-strand	114	1	3
α-helix	120-122	3
α-helix	124-129	6
β-strand	132-139	8	2
α-helix	141-143	3
α-helix	146-155	10
α-helix	157	1
α-helix	160-162	3
β-strand	164-167	4	2
α-helix	171-176	6
α-helix	177-188	12
β-strand	189-190	2	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Integrin alpha-M	A	protein	215	Homo sapiens	P11215 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>8CE6_1 Integrin alpha-M (chains A)
MHHHHHHSSGVDLGTENLYFQSSDIAFLIDGSGSIIPHDFRRMKEFVSTVMEQLKKSKSL
FSLMQYSEEFRIHFTFKEFQNNPNPRSLVKPITQLLGRTHTATGIRKVVRELFNITNGAR
KNAFKILVVITDGEKFGDPLGYEDVIPEADREGVIRYVIGVGDAFRSEKSRQELNTIASK
PPRDHVFQVNNFEALKTIQNQLREKIFAIEGEPEA

Primary citation

Crystal structure of human Cd11b I domain in P212121 space group. Koekemoer, L., Williams, E., Ni, X. et al. To be published.

Other PDB entries of the same protein (UniProt P11215 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1MF7 1.25 Å, Integrin alpha M I domain
1NA5 1.5 Å, Integrin alpha M I domain
1IDO 1.7 Å, I-domain from integrin CR3, MG2+ bound
1JLM 2.0 Å, I-domain from integrin CR3, MN2+ bound
4XW2 2.0 Å, Structural basis for simvastatin competitive antagonism of complement receptor 3
8CE9 2.11 Å, Crystal structure of human Cd11b I domain in C121 space group
1M1U 2.3 Å, An isoleucine-based allosteric switch controls affinity and shape shifting in integrin…
1N9Z 2.5 Å, Integrin alpha M I domain mutant
9RM9 2.6 Å, Cryo-EM structure of alphaM/beta2 headpiece complex without alphaM I-domain - the…
1BHO 2.7 Å, Mac-1 I domain magnesium complex
1BHQ 2.7 Å, Mac-1 I domain cadmium complex
1IDN 2.7 Å, Mac-1 I domain metal free

Browse structure collections

About this viewer

MolViewer shows 8CE6 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.