4XW2: Integrin alpha-M

Structural basis for simvastatin competitive antagonism of complement receptor 3. Determined by X-ray diffraction at 2.0 Å resolution. Released 13 Jan 2016.

Method: X-ray diffraction
Resolution: 2.0 Å
Organism: Homo sapiens
Chains: 1
Atoms: 1,587
Mol. weight: 22.94 kDa
Ligands: SIM, MG
Released: 13 Jan 2016

Explore 4XW2 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4XW2 contains 13 α-helices and 8 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 13 helices, 8 β-strands

Element	Residues	Length	Sheet
β-strand	133-140	8	1
α-helix	147-163	17
β-strand	169-176	8	1
β-strand	180-184	5	1
α-helix	186-191	6
α-helix	195-199	5
β-strand	209	1	2
α-helix	211-217	7
α-helix	218-222	5
α-helix	225-227	3
α-helix	233	1
β-strand	234-241	8	1
β-strand	246	1	2
α-helix	252-254	3
α-helix	256-261	6
β-strand	265-270	6	1
α-helix	278-287	10
α-helix	289	1
α-helix	292-294	3
β-strand	296-298	3	1
α-helix	303-314	12

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Integrin alpha-M	A	protein	198	Homo sapiens	P11215 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>4XW2_1 Integrin alpha-M (chains A)
GAMGSPQEDSDIAFLIDGSGSIIPHDFRRMKEFVSTVMEQLKKSKTLFSLMQYSEEFRIH
FTFKEFQNNPNPRSLVKPITQLLGRTHTATGIRKVVRELFNITNGARKNAFKILVVITDG
EKFGDPLGYEDVIPEADREGVIRYVIGVGDAFRSEKSRQELNTIASKPPRDHVFQVNNFE
ALKTIQNQLREKGFAIEG

Ligands and cofactors

ID	Name	Formula	Copies
SIM	Simvastatin acid	C25 H40 O6	1
MG	Magnesium ion	Mg	1

Primary citation

Structural Basis for Simvastatin Competitive Antagonism of Complement Receptor 3. Jensen, M.R., Bajic, G., Zhang, X. et al. J Biol Chem (2016) 291:16963-16976. DOI 10.1074/jbc.M116.732222 · PubMed

Other PDB entries of the same protein (UniProt P11215 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1MF7 1.25 Å, Integrin alpha M I domain
1NA5 1.5 Å, Integrin alpha M I domain
8CE6 1.58 Å, Crystal structure of human Cd11b I domain in P212121 space group
1IDO 1.7 Å, I-domain from integrin CR3, MG2+ bound
1JLM 2.0 Å, I-domain from integrin CR3, MN2+ bound
8CE9 2.11 Å, Crystal structure of human Cd11b I domain in C121 space group
1M1U 2.3 Å, An isoleucine-based allosteric switch controls affinity and shape shifting in integrin…
1N9Z 2.5 Å, Integrin alpha M I domain mutant
9RM9 2.6 Å, Cryo-EM structure of alphaM/beta2 headpiece complex without alphaM I-domain - the…
1BHO 2.7 Å, Mac-1 I domain magnesium complex
1BHQ 2.7 Å, Mac-1 I domain cadmium complex
1IDN 2.7 Å, Mac-1 I domain metal free

Browse structure collections

About this viewer

MolViewer shows 4XW2 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.