1NCN: The receptor-binding domain of human B7-2

the receptor-binding domain of human B7-2. Determined by X-ray diffraction at 2.7 Å resolution. Released 11 Mar 2003.

Method: X-ray diffraction
Resolution: 2.7 Å
Organism: Homo sapiens
Chains: 2
Atoms: 1,804
Mol. weight: 25.7 kDa
Released: 11 Mar 2003

Explore 1NCN in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1NCN contains 5 α-helices and 20 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 2 helices, 10 β-strands

Element	Residues	Length	Sheet
β-strand	1-6	6	1
β-strand	11-14	4	2
α-helix	25-27	3
β-strand	28-34	7	1
β-strand	39-44	6	1
β-strand	47-48	2	1
β-strand	53	1	1
β-strand	61-64	4	2
β-strand	69-72	4	2
α-helix	77-79	3
β-strand	81-90	10	1
β-strand	95-108	14	1

Chain B: 3 helices, 10 β-strands

Element	Residues	Length	Sheet
β-strand	1-6	6	3
β-strand	11-14	4	4
α-helix	25-27	3
β-strand	28-34	7	3
β-strand	39-44	6	3
β-strand	47-49	3	3
β-strand	53	1	3
β-strand	61-64	4	4
β-strand	69-72	4	4
α-helix	73	1
α-helix	77-79	3
β-strand	81-91	11	3
β-strand	94-108	15	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
T lymphocyte activation antigen CD86	A, B	protein	110	Homo sapiens	P42081 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>1NCN_1 T lymphocyte activation antigen CD86 (chains A, B)
MLKIQAYFNETADLPCQFANSQNQSLSELVVFWQDQENLVLNEVYLGKEKFDSVHSKYMG
RTSFDSDSWTLRLHNLQIKDKGLYQCIIHHKKPTGMIRIHQMNSELSVLA

Primary citation

Crystal Structure of the Receptor-Binding Domain of Human B7-2: Insights into Organization and Signaling. Zhang, X., Schwartz, J.D., Almo, S.C. et al. Proc Natl Acad Sci U S A (2003) 100:2586-2591. DOI 10.1073/pnas.252771499 · PubMed

Other PDB entries of the same protein (UniProt P42081 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5YXK 1.9 Å, High resolution crystal structure of Human B7-2 IgV domain in P21 space group
8HXB 2.7 Å, Cryo-EM structure of MPXV M2 hexamer in complex with human B7.2
8HXC 3.12 Å, Cryo-EM structure of MPXV M2 heptamer in complex with human B7.2
1I85 3.2 Å, Crystal structure of the ctla-4/B7-2 complex
8FXX 3.26 Å, Cryo-EM structure of cowpox virus M2 in complex with human B7.2 (heptameric ring)
8FXY 3.34 Å, Cryo-EM structure of cowpox virus M2 in complex with human B7.2 (hexameric ring)

Browse structure collections

About this viewer

MolViewer shows 1NCN directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.