1O6O: Importin Beta aa1-442

Importin Beta aa1-442 bound to five FxFG repeats from yeast Nsp1p. Second crystal form. Determined by X-ray diffraction at 2.8 Å resolution. Released 17 Oct 2003.

Method: X-ray diffraction
Resolution: 2.8 Å
Organisms: HOMO SAPIENS, SACCHAROMYCES CEREVISIAE
Chains: 6
Atoms: 10,433
Mol. weight: 185.82 kDa
Released: 17 Oct 2003

Explore 1O6O in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1O6O contains 88 α-helices and 0 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains A and B: 29 helices, 0 β-strands

Element	Residues	Length
α-helix	3-9	7
α-helix	15-31	17
α-helix	33-45	13
α-helix	51-62	12
α-helix	70-81	12
α-helix	85-98	14
α-helix	108-120	13
α-helix	121-123	3
α-helix	129-138	10
α-helix	144-160	17
α-helix	163-166	4
α-helix	170-181	12
α-helix	188-201	14
α-helix	202-204	3
α-helix	206-210	5
α-helix	212-225	14
α-helix	231-247	17
α-helix	250-252	3
α-helix	253-255	3
α-helix	256-260	5
α-helix	261-269	9
α-helix	273-301	29
α-helix	314-329	16
α-helix	344-358	15
α-helix	360-375	16
α-helix	380-392	13
α-helix	399-407	9
α-helix	410-418	9
α-helix	422-438	17

Chain C: 29 helices, 0 β-strands

Element	Residues	Length
α-helix	3-9	7
α-helix	15-31	17
α-helix	33-45	13
α-helix	51-62	12
α-helix	70-81	12
α-helix	85-98	14
α-helix	108-120	13
α-helix	121-123	3
α-helix	129-138	10
α-helix	144-160	17
α-helix	163-166	4
α-helix	171-181	11
α-helix	188-201	14
α-helix	202-204	3
α-helix	206-210	5
α-helix	212-225	14
α-helix	231-247	17
α-helix	250-252	3
α-helix	253-255	3
α-helix	256-260	5
α-helix	261-269	9
α-helix	273-301	29
α-helix	314-329	16
α-helix	344-358	15
α-helix	360-375	16
α-helix	380-392	13
α-helix	399-407	9
α-helix	410-418	9
α-helix	422-435	14

Chain E: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	10-12	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Importin beta-1 subunit	A, B, C	protein	442	HOMO SAPIENS	Q14974 (AlphaFold model)
Nucleoporin NSP1	D, E, F	protein	119	SACCHAROMYCES CEREVISIAE	P14907 (AlphaFold model)

Sequence of entity 1 (A, B, C), FASTA

>1O6O_1 IMPORTIN BETA-1 SUBUNIT (chains A, B, C)
MELITILEKTVSPDRLELEAAQKFLERAAVENLPTFLVELSRVLANPGNSQVARVAAGLQ
IKNSLTSKDPDIKAQYQQRWLAIDANARREVKNYVLHTLGTETYRPSSASQCVAGIACAE
IPVNQWPELIPQLVANVTNPNSTEHMKESTLEAIGYICQDIDPEQLQDKSNEILTAIIQG
MRKEEPSNNVKLAATNALLNSLEFTKANFDKESERHFIMQVVCEATQCPDTRVRVAALQN
LVKIMSLYYQYMETYMGPALFAITIEAMKSDIDEVALQGIEFWSNVCDEEMDLAIEASEA
AEQGRPPEHTSKFYAKGALQYLVPILTQTLTKQDENDDDDDWNPCKAAGVCLMLLATCCE
DDIVPHVLPFIKEHIKNPDWRYRDAAVMAFGCILEGPEPSQLKPLVIQAMPTLIELMKDP
SVVVRDTAAWTVGRICELLPEA

Sequence of entity 2 (D, E, F), FASTA

>1O6O_2 NUCLEOPORIN NSP1 (chains D, E, F)
MGSSTKSNEKKDSGSSKPAFSFGAKPDEKKNDEVSKPAFSFGAKANEKKESDESKSAFSF
GSKPTGKEEGDGAKAAISFGAKPEEQKSSDTSKPAFTFGAQKDNEKKTEESSTGKSMQA

Primary citation

Glfg and Fxfg Nucleoporins Bind to Overlapping Sites on Importin-Beta. Bayliss, R., Littlewood, T., Strawn, L.A. et al. J Biol Chem (2002) 277:50597. DOI 10.1074/JBC.M209037200 · PubMed

Other PDB entries of the same protein (UniProt Q14974 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1IBR 2.3 Å, Complex of ran with importin beta
1QGR 2.3 Å, Structure of importin beta bound to the ibb domain of importin alpha (II crystal form,…
2P8Q 2.35 Å, Crystal Structure of human Importin beta bound to the Snurportin1 IBB-domain
1QGK 2.5 Å, Structure of importin beta bound to the ibb domain of importin alpha
3W5K 2.6 Å, Crystal structure of Snail1 and importin beta complex
9N85 2.6 Å, Cryo-EM structure of human importin beta:Ran-GTP:RanBP1 trimeric complex
1F59 2.8 Å, Importin-beta-fxfg nucleoporin complex
1O6P 2.8 Å, Importin Beta bound to a GLFG Nucleoporin peptide
2QNA 2.84 Å, Crystal structure of human Importin-beta (127-876) in complex with the IBB-domain of…
1M5N 2.9 Å, Crystal structure of HEAT repeats (1-11) of importin b bound to the non-classical…
3LWW 3.15 Å, Structure of an open and closed conformation of Human Importin Beta bound to the…
2Q5D 3.2 Å, Crystal Structure of Human Importin Beta bound to the Snurportin1 IBB-domain second…

Browse structure collections

About this viewer

MolViewer shows 1O6O directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.