1O6P: Importin Beta

Importin Beta bound to a GLFG Nucleoporin peptide. Determined by X-ray diffraction at 2.8 Å resolution. Released 24 Apr 2003.

Method: X-ray diffraction
Resolution: 2.8 Å
Organisms: HOMO SAPIENS, SYNTHETIC CONSTRUCT
Chains: 6
Atoms: 7,022
Mol. weight: 102.24 kDa
Released: 24 Apr 2003

Explore 1O6P in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1O6P contains 60 α-helices and 0 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 29 helices, 0 β-strands

Element	Residues	Length
α-helix	3-8	6
α-helix	15-31	17
α-helix	33-45	13
α-helix	51-63	13
α-helix	70-81	12
α-helix	85-98	14
α-helix	110-120	11
α-helix	121-123	3
α-helix	129-138	10
α-helix	144-160	17
α-helix	163-165	3
α-helix	170-179	10
α-helix	188-201	14
α-helix	202-204	3
α-helix	206-210	5
α-helix	212-225	14
α-helix	231-247	17
α-helix	249-251	3
α-helix	253-255	3
α-helix	256-260	5
α-helix	261-269	9
α-helix	273-302	30
α-helix	314-329	16
α-helix	344-358	15
α-helix	364-375	12
α-helix	380-393	14
α-helix	399-415	17
α-helix	416-418	3
α-helix	422-437	16

Chain B: 31 helices, 0 β-strands

Element	Residues	Length
α-helix	3-8	6
α-helix	15-31	17
α-helix	33-45	13
α-helix	51-63	13
α-helix	70-81	12
α-helix	85-98	14
α-helix	107	1
α-helix	109-120	12
α-helix	121-123	3
α-helix	129-138	10
α-helix	144-160	17
α-helix	163-165	3
α-helix	170-181	12
α-helix	188-201	14
α-helix	202-204	3
α-helix	206-210	5
α-helix	212-226	15
α-helix	231-247	17
α-helix	249-251	3
α-helix	253-255	3
α-helix	256-260	5
α-helix	261-269	9
α-helix	273-302	30
α-helix	314-329	16
α-helix	344-358	15
α-helix	360-363	4
α-helix	364-375	12
α-helix	380-392	13
α-helix	399-415	17
α-helix	416-418	3
α-helix	422-437	16

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Importin beta-1 subunit	A, B	protein	442	HOMO SAPIENS	Q14974 (AlphaFold model)
Synthetic glfg peptide	C, D, E, F	protein	9	SYNTHETIC CONSTRUCT	Q02630 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>1O6P_1 IMPORTIN BETA-1 SUBUNIT (chains A, B)
MELITILEKTVSPDRLELEAAQKFLERAAVENLPTFLVELSRVLANPGNSQVARVAAGLQ
IKNSLTSKDPDIKAQYQQRWLAIDANARREVKNYVLHTLGTETYRPSSASQCVAGIACAE
IPVNQWPELIPQLVANVTNPNSTEHMKESTLEAIGYICQDIDPEQLQDKSNEILTAIIQG
MRKEEPSNNVKLAATNALLNSLEFTKANFDKESERHFIMQVVCEATQCPDTRVRVAALQN
LVKIMSLYYQYMETYMGPALFAITIEAMKSDIDEVALQGIEFWSNVCDEEMDLAIEASEA
AEQGRPPEHTSKFYAKGALQYLVPILTQTLTKQDENDDDDDWNPCKAAGVCLMLLATCCE
DDIVPHVLPFIKEHIKNPDWRYRDAAVMAFGCILEGPEPSQLKPLVIQAMPTLIELMKDP
SVVVRDTAAWTVGRICELLPEA

Sequence of entity 2 (C, D, E, F), FASTA

>1O6P_2 SYNTHETIC GLFG PEPTIDE (chains C, D, E, F)
DSGGLFGSK

Primary citation

Glfg and Fxfg Nucleoporins Bind to Overlapping Sites on Importin-Beta. Bayliss, R., Littlewood, T., Strawn, L.A. et al. J Biol Chem (2002) 277:50597. DOI 10.1074/JBC.M209037200 · PubMed

Other PDB entries of the same protein (UniProt Q14974 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1IBR 2.3 Å, Complex of ran with importin beta
1QGR 2.3 Å, Structure of importin beta bound to the ibb domain of importin alpha (II crystal form,…
2P8Q 2.35 Å, Crystal Structure of human Importin beta bound to the Snurportin1 IBB-domain
1QGK 2.5 Å, Structure of importin beta bound to the ibb domain of importin alpha
3W5K 2.6 Å, Crystal structure of Snail1 and importin beta complex
9N85 2.6 Å, Cryo-EM structure of human importin beta:Ran-GTP:RanBP1 trimeric complex
1F59 2.8 Å, Importin-beta-fxfg nucleoporin complex
1O6O 2.8 Å, Importin Beta aa1-442 bound to five FxFG repeats from yeast Nsp1p. Second crystal form
2QNA 2.84 Å, Crystal structure of human Importin-beta (127-876) in complex with the IBB-domain of…
1M5N 2.9 Å, Crystal structure of HEAT repeats (1-11) of importin b bound to the non-classical…
3LWW 3.15 Å, Structure of an open and closed conformation of Human Importin Beta bound to the…
2Q5D 3.2 Å, Crystal Structure of Human Importin Beta bound to the Snurportin1 IBB-domain second…

Browse structure collections

About this viewer

MolViewer shows 1O6P directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.