1O6V: Internalin a

Internalin (INLA, Listeria monocytogenes) - functional domain, uncomplexed. Determined by X-ray diffraction at 1.5 Å resolution. Released 23 Dec 2002.

Method: X-ray diffraction
Resolution: 1.5 Å
Organism: LISTERIA MONOCYTOGENES
Chains: 2
Atoms: 10,809
Mol. weight: 100.56 kDa
Ligands: CA
Released: 23 Dec 2002

Explore 1O6V in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1O6V contains 45 α-helices and 56 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 23 helices, 28 β-strands

Element	Residues	Length	Sheet
β-strand	42-43	2	1
α-helix	44-47	4
α-helix	51-60	10
β-strand	69-70	2	1
α-helix	72-76	5
β-strand	80-82	3	2
α-helix	94-96	3
β-strand	102-104	3	2
α-helix	114-116	3
β-strand	124-126	3	2
α-helix	136-138	3
β-strand	146-148	3	2
α-helix	158-160	3
β-strand	168-176	9	2
α-helix	180-182	3
β-strand	190-195	6	2
α-helix	201-203	3
β-strand	211-213	3	2
α-helix	223-227	5
β-strand	233-235	3	2
α-helix	245-249	5
β-strand	255-257	3	2
α-helix	267-271	5
β-strand	277-279	3	2
α-helix	289-291	3
β-strand	299-301	3	2
α-helix	311-313	3
β-strand	321-323	3	2
α-helix	333-337	5
β-strand	343-345	3	2
α-helix	355-359	5
β-strand	365-367	3	2
α-helix	377-379	3
β-strand	387-389	3	2
β-strand	397	1	3
α-helix	399-401	3
β-strand	409-411	3	2
β-strand	415-418	4	4
α-helix	419	1
α-helix	421	1
β-strand	429-431	3	5
β-strand	435	1	3
α-helix	440	1
β-strand	441	1	3
α-helix	442-444	3
β-strand	446-447	2	4
α-helix	448-450	3
β-strand	452-454	3	5
β-strand	457-459	3	5
β-strand	468-479	12	4
β-strand	482-493	12	4

Chain B: 22 helices, 28 β-strands

Element	Residues	Length	Sheet
β-strand	42-43	2	6
α-helix	44-47	4
α-helix	51-60	10
β-strand	69-70	2	6
α-helix	72-75	4
β-strand	80-82	3	7
α-helix	94-96	3
β-strand	102-104	3	7
α-helix	114-116	3
β-strand	124-126	3	7
α-helix	136-138	3
β-strand	146-148	3	7
α-helix	158-160	3
β-strand	168-176	9	7
α-helix	180-182	3
β-strand	190-195	6	7
α-helix	201-203	3
β-strand	211-213	3	7
α-helix	223-227	5
β-strand	233-235	3	7
α-helix	245-249	5
β-strand	255-257	3	7
α-helix	267-271	5
β-strand	277-279	3	7
α-helix	289-291	3
β-strand	299-301	3	7
α-helix	311-313	3
β-strand	321-323	3	7
α-helix	333-337	5
β-strand	343-345	3	7
α-helix	355-359	5
β-strand	365-367	3	7
α-helix	377-379	3
β-strand	387-389	3	7
β-strand	397	1	8
α-helix	399-401	3
β-strand	409-411	3	7
β-strand	415-418	4	9
α-helix	419-421	3
β-strand	429-431	3	10
β-strand	435	1	8
α-helix	440	1
β-strand	441	1	8
α-helix	442-444	3
β-strand	446-447	2	9
α-helix	448-450	3
β-strand	452-454	3	10
β-strand	457-459	3	10
β-strand	468-479	12	9
β-strand	482-493	12	9

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Internalin a	A, B	protein	466	LISTERIA MONOCYTOGENES	P0DJM0 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>1O6V_1 INTERNALIN A (chains A, B)
GPLGSATITQDTPINQIFTDTALAEKMKTVLGKTNVTDTVSQTDLDQVTTLQADRLGIKS
IDGVEYLNNLTQINFSNNQLTDITPLKNLTKLVDILMNNNQIADITPLANLTNLTGLTLF
NNQITDIDPLKNLTNLNRLELSSNTISDISALSGLTSLQQLSFGNQVTDLKPLANLTTLE
RLDISSNKVSDISVLAKLTNLESLIATNNQISDITPLGILTNLDELSLNGNQLKDIGTLA
SLTNLTDLDLANNQISNLAPLSGLTKLTELKLGANQISNISPLAGLTALTNLELNENQLE
DISPISNLKNLTYLTLYFNNISDISPVSSLTKLQRLFFYNNKVSDVSSLANLTNINWLSA
GHNQISDLTPLANLTRITQLGLNDQAWTNAPVNYKANVSIPNTVKNVTGALIAPATISDG
GSYTEPDITWNLPSYTNEVSYTFSQPVTIGKGTTTFSGTVTQPLKA

Ligands and cofactors

ID	Name	Formula	Copies
CA	Calcium ion	Ca	2

Primary citation

Structure of Internalin, a Major Invasion Protein of Listeria Monocytogenes, in Complex with its Human Receptor E-Cadherin. Schubert, W.-D., Urbanke, C., Ziehm, T. et al. Cell (2002) 111:825. DOI 10.1016/S0092-8674(02)01136-4 · PubMed

Other PDB entries of the same protein (UniProt P0DJM0 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8H63 1.53 Å, Crystal structure of Internalin A from Listeria monocytogenes with nanobody VHH10 bound
1O6T 1.6 Å, Internalin (INLA, Listeria monocytogenes) - functional domain, uncomplexed
2OMZ 1.6 Å, Crystal structure of InlA Y369A/hEC1 complex
2OMY 1.7 Å, Crystal structure of InlA S192N/hEC1 complex
1O6S 1.8 Å, Internalin (Listeria monocytogenes) / E-Cadherin (human) Recognition Complex
2OMU 1.8 Å, Crystal structure of InlA G194S+S Y369S/hEC1 complex
2OMW 1.85 Å, Crystal structure of InlA S192N Y369S/mEC1 complex
2OMV 1.9 Å, Crystal structure of InlA S192N Y369S/hEC1 complex
8H62 1.91 Å, Crystal structure of Internalin A from Listeria monocytogenes with human E-cadherin EC12
8H64 2.35 Å, Crystal structure of Internalin A from Listeria monocytogenes with nanobody VHH24 bound

Browse structure collections

About this viewer

MolViewer shows 1O6V directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.