1OAI: Nuclear RNA export factor

Complex between Tap UBA domain and FxFG nucleoporin peptide. Determined by X-ray diffraction at 1.0 Å resolution. Released 20 Feb 2003.

Method: X-ray diffraction
Resolution: 1.0 Å
Organism: HOMO SAPIENS
Chains: 2
Atoms: 669
Mol. weight: 7.73 kDa
Released: 20 Feb 2003

Explore 1OAI in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1OAI contains 4 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 4 helices, 0 β-strands

Element	Residues	Length
α-helix	565-578	14
α-helix	582-591	10
α-helix	596-608	13
α-helix	614-617	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Nuclear RNA export factor	A	protein	59	HOMO SAPIENS	Q9UBU9 (AlphaFold model)
Fxfg nucleoporin peptide	B	protein	9	HOMO SAPIENS

Sequence of entity 1 (A), FASTA

>1OAI_1 NUCLEAR RNA EXPORT FACTOR (chains A)
PTLSPEQQEMLQAFSTQSGMNLEWSQKCLQDNNWDYTRSAQAFTHLKAKGEIPEVAFMK

Sequence of entity 2 (B), FASTA

>1OAI_2 FXFG NUCLEOPORIN PEPTIDE (chains B)
DSGFSFGSK

Primary citation

Structural Basis for the Interaction between the Tap/Nxf1 Uba Domain and Fg Nucleoporins at 1 A Resolution. Grant, R.P., Neuhaus, D., Stewart, M. J Mol Biol (2003) 326:849. DOI 10.1016/S0022-2836(02)01474-2 · PubMed

Other PDB entries of the same protein (UniProt Q9UBU9 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9I8A 1.5 Å, NXT1-NXF1 complex crystallized in space group P65 2 2
1JKG 1.9 Å, Structural basis for the recognition of a nucleoporin FG-repeat by the NTF2-like domain…
3RW6 2.3 Å, Structure of nuclear RNA export factor TAP bound to CTE RNA
2Z5K 2.6 Å, Complex of Transportin 1 with TAP NLS
1JN5 2.8 Å, Structural basis for the recognition of a nucleoporin FG-repeat by the NTF2-like domain…
1FO1 2.9 Å, Crystal structure of the RNA-binding domain of the mRNA export factor tap
2Z5M 3.0 Å, Complex of Transportin 1 with TAP NLS, crystal form 2
3RW7 3.0 Å, Structure of N-terminal domain of nuclear RNA export factor TAP
1FT8 3.15 Å, Crystal structure of the RNA-binding domain of the mRNA export factor tap
4WYK 3.4 Å, Structure of the LRR and NTF2-like domains of NXF1 complexed with NXT1
1KOH 3.8 Å, The crystal structure and mutational analysis of a novel RNA-binding domain found in the…
1KOO 3.8 Å, The crystal structure and mutational analysis of a novel RNA-binding domain found in the…

Browse structure collections

About this viewer

MolViewer shows 1OAI directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.