Solution structure of OCT3 pou-homeodomain. Determined by solution NMR. Released 15 Sept 1995.
Explore 1OCP in 3D Show helices and sheets RCSB PDB PDBe
1OCP contains 3 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 17-27 | 11 | |
| α-helix | 35-45 | 11 | |
| α-helix | 49-60 | 12 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| OCT-3 | A | protein | 67 | Mus musculus | P20263 (AlphaFold model) |
>1OCP_1 OCT-3 (chains A) METLVQARKRKRTSIENRVRWSLETMFLKCPKPSLQQITHIANQLGLEKDVVRVWFCNRR QKGKRSS
Structure of the Oct-3 POU-Homeodomain in Solution, as Determined by Triple Resonance Heteronuclear Multidimensional NMR Spectroscopy. Morita, E.H., Shirakawa, M., Hayashi, F. et al. Protein Sci (1995) 4:729-739. PubMed
Other PDB entries of the same protein (UniProt P20263 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 1OCP directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.