1OE9: Myosin va

Crystal structure of Myosin V motor with essential light chain-nucleotide-free. Determined by X-ray diffraction at 2.05 Å resolution. Released 26 Sept 2003.

Method: X-ray diffraction
Resolution: 2.05 Å
Organisms: GALLUS GALLUS, HOMO SAPIENS
Chains: 2
Atoms: 7,263
Mol. weight: 108.79 kDa
Released: 26 Sept 2003

Explore 1OE9 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1OE9 contains 46 α-helices and 34 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 37 helices, 29 β-strands

Element	Residues	Length	Sheet
β-strand	12-17	6	1
β-strand	21-27	7	1
β-strand	37-41	5	1
β-strand	48-51	4	1
α-helix	58-61	4
β-strand	62	1	1
α-helix	63-65	3
α-helix	66-68	3
β-strand	73	1	2
α-helix	74-76	3
α-helix	82-95	14
β-strand	100-103	4	2
β-strand	106-110	5	2
α-helix	121-127	7
α-helix	139-153	15
β-strand	157-162	6	2
α-helix	169-183	15
α-helix	192-198	7
α-helix	200-207	8
β-strand	208-211	4	3
β-strand	214-218	5	3
β-strand	221-228	8	2
β-strand	234-242	9	2
α-helix	246-249	4
β-strand	259	1	3
α-helix	260-267	8
α-helix	272-277	6
α-helix	282-284	3
α-helix	286-289	4
α-helix	301-314	14
α-helix	319-337	19
β-strand	341-343	3	4
β-strand	347-349	3	4
α-helix	355-364	10
α-helix	368-374	7
β-strand	377-380	4	5
β-strand	387-390	4	5
α-helix	393-423	31
α-helix	428-429	2
β-strand	431-438	8	2
β-strand	447	1	6
α-helix	449-479	31
α-helix	493-500	8
α-helix	505-513	9
α-helix	520-531	12
β-strand	538-539	2	6
β-strand	547-551	5	6
β-strand	556-560	5	6
α-helix	564-568	5
β-strand	569	1	7
α-helix	574-581	8
α-helix	588-592	5
β-strand	635	1	7
α-helix	636-652	17
β-strand	655-662	8	2
α-helix	675-684	10
α-helix	687-696	10
β-strand	700-703	4	8
α-helix	704-711	8
α-helix	712-714	3
α-helix	717-719	3
α-helix	724-735	12
α-helix	739-741	3
β-strand	742-744	3	8
β-strand	748-751	4	8
α-helix	755-792	38

Chain B: 9 helices, 5 β-strands

Element	Residues	Length	Sheet
α-helix	6-18	13
β-strand	26-28	3	9
α-helix	29-38	10
α-helix	45-52	8
α-helix	57-62	6
β-strand	64-66	3	9
α-helix	67-78	12
α-helix	87-94	8
β-strand	103-105	3	10
α-helix	106-115	10
α-helix	122-129	8
β-strand	133	1	10
β-strand	138-140	3	10
α-helix	141-149	9

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Myosin va	A	protein	795	GALLUS GALLUS	Q02440 (AlphaFold model)
Myosin light chain 1, slow-twitch muscle a isoform	B	protein	151	HOMO SAPIENS	P14649 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1OE9_1 MYOSIN VA (chains A)
MAASELYTKYARVWIPDPEEVWKSAELLKDYKPGDKVLQLRLEEGKDLEYCLDPKTKELP
PLRNPDILVGENDLTALSYLHEPAVLHNLKVRFIDSKLIYTYCGIVLVAINPYEQLPIYG
EDIINAYSGQNMGDMDPHIFAVAEEAYKQMARDERNQSIIVSGESGAGKTVSAKYAMRYF
ATVSGSASEANVEEKVLASNPIMESIGNAKTTRNDNSSRFGKYIEIGFDKRYRIIGANMR
TYLLEKSRVVFQAEEERNYHIFYQLCASAALPEFKTLRLGNANYFHYTKQGGSPVIDGID
DAKEMVNTRQACTLLGISDSYQMGIFRILAGILHLGNVEFASRDSDSCAIPPKHDPLTIF
CDLMGVDYEEMAHWLCHRKLATATETYIKPISKLHAINARDALAKHIYANLFNWIVDHVN
KALHSTVKQHSFIGVLDIYGFETFEINSFEQFCINYANEKLQQQFNMHVFKLEQEEYMKE
QIPWTLIDFYDNQPCINLIEAKMGVLDLLDEECKMPKGSDDTWAQKLYNTHLNKCALFEK
PRLSNKAFIIKHFADKVEYQCEGFLEKNKDTVYEEQIKVLKSSKKFKLLPELFQDEEKAI
SPTSATPSGRVPLSRTPVKPAKARPGQTSKEHKKTVGHQFRNSLHLLMETLNATTPHYVR
CIKPNDFKFPFTFDEKRAVQQLRACGVLETIRISAAGFPSRWTYQEFFSRYRVLMKQKDV
LSDRKQTCKNVLEKLILDKDKYQFGKTKIFFRAGQVAYLEKIRADKLRAACIRIQKTIRG
WLMRKKYMRMRRGDA

Sequence of entity 2 (B), FASTA

>1OE9_2 MYOSIN LIGHT CHAIN 1, SLOW-TWITCH MUSCLE A ISOFORM (chains B)
MIEFNKDQLEEFKEAFELFDRVGDGKILYSQCGDVMRALGQNPTNAEVLKVLGNPKSDEL
KSRRVDFETFLPMLQAVAKNRGQGTYEDYLEGFRVFDKEGNGKVMGAELRHVLTTLGEKM
TEEEVETVLAGHEDSNGCINYEAFLKHILSV

Primary citation

A Structural State of the Myosin V Motor without Bound Nucleotide. Coureux, P.-D., Wells, A.L., Menetrey, J. et al. Nature (2003) 425:419. DOI 10.1038/NATURE01927 · PubMed

Other PDB entries of the same protein (UniProt Q02440 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1W7J 2.0 Å, Crystal Structure Of Myosin V Motor With Essential Light Chain + ADP-BeFx - Near Rigor
1W8J 2.7 Å, Crystal Structure Of Myosin V Motor Domain - Nucleotide-Free
7PMD 2.9 Å, Cryo-EM structure of the actomyosin-V complex in the post-rigor transition state…
7PME 2.9 Å, Cryo-EM structure of the actomyosin-V complex in the post-rigor transition state…
1W7I 3.0 Å, Crystal Structure Of Myosin V Motor Without nucleotide soaked in 10 mM MgADP
7PM6 3.0 Å, Cryo-EM structure of the actomyosin-V complex in the strong-ADP state (central 3er/2er)
7PM5 3.1 Å, Cryo-EM structure of the actomyosin-V complex in the strong-ADP state (central 1er)
7PLU 3.2 Å, Cryo-EM structure of the actomyosin-V complex in the rigor state (central 3er/2er)
7PLY 3.2 Å, Cryo-EM structure of the actomyosin-V complex in the rigor state (central 1er, young…
7PLZ 3.2 Å, Cryo-EM structure of the actomyosin-V complex in the rigor state (central 3er/2er, young…
7PLT 3.3 Å, Cryo-EM structure of the actomyosin-V complex in the rigor state (central 1er)
7PMG 3.3 Å, Cryo-EM structure of the actomyosin-V complex in the post-rigor transition state…

Browse structure collections

About this viewer

MolViewer shows 1OE9 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.