1W8J: Myosin V Motor Domain - Nucleotide-Free

Crystal Structure Of Myosin V Motor Domain - Nucleotide-Free. Determined by X-ray diffraction at 2.7 Å resolution. Released 22 Feb 2005.

Method: X-ray diffraction
Resolution: 2.7 Å
Organism: GALLUS GALLUS
Chains: 4
Atoms: 22,756
Mol. weight: 352.43 kDa
Released: 22 Feb 2005

Explore 1W8J in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1W8J contains 148 α-helices and 109 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 36 helices, 26 β-strands

Element	Residues	Length	Sheet
β-strand	13-17	5	1
β-strand	21-25	5	1
α-helix	30-32	3
β-strand	39-40	2	2
β-strand	48-49	2	2
α-helix	59-61	3
β-strand	62	1	1
α-helix	63-65	3
β-strand	73	1	3
α-helix	74-76	3
α-helix	82-94	13
β-strand	100-103	4	3
β-strand	106-110	5	3
α-helix	121-127	7
α-helix	130-131	2
α-helix	139-153	15
β-strand	157-162	6	3
α-helix	169-180	12
α-helix	192-207	16
β-strand	208-209	2	4
β-strand	217-218	2	4
β-strand	221-228	8	3
β-strand	234-242	9	3
α-helix	246-249	4
β-strand	259	1	4
α-helix	260-266	7
α-helix	272-274	3
α-helix	282-284	3
α-helix	286-289	4
α-helix	301-314	14
α-helix	319-336	18
β-strand	341-344	4	5
β-strand	347-349	3	5
α-helix	355-364	10
α-helix	368-374	7
β-strand	377-381	5	6
β-strand	386-390	5	6
α-helix	393-423	31
β-strand	431-437	7	3
α-helix	449-480	32
α-helix	484-486	3
α-helix	493-500	8
α-helix	505-513	9
α-helix	520-531	12
β-strand	538-539	2	7
β-strand	547-552	6	7
β-strand	555-560	6	7
α-helix	564-568	5
α-helix	574-580	7
α-helix	588-593	6
α-helix	636-652	17
β-strand	655-662	8	3
α-helix	675-684	10
α-helix	687-694	8
β-strand	700-703	4	8
α-helix	704-711	8
α-helix	712-714	3
α-helix	724-735	12
α-helix	739-741	3
β-strand	742-744	3	8
β-strand	748-751	4	8
α-helix	755-762	8

Chain B: 36 helices, 29 β-strands

Element	Residues	Length	Sheet
α-helix	3-6	4
β-strand	12-17	6	9
β-strand	21-27	7	9
β-strand	37-39	3	10
β-strand	40-41	2	9
β-strand	49-51	3	10
α-helix	58-61	4
β-strand	62	1	9
α-helix	63-65	3
β-strand	73	1	11
α-helix	74-76	3
α-helix	82-94	13
β-strand	100-103	4	11
β-strand	105-110	6	11
α-helix	121-127	7
α-helix	130-131	2
α-helix	139-152	14
β-strand	157-162	6	11
α-helix	169-181	13
α-helix	192-207	16
β-strand	208-211	4	12
β-strand	214-218	5	12
β-strand	221-228	8	11
β-strand	234-242	9	11
α-helix	246-249	4
α-helix	260-266	7
α-helix	272-274	3
α-helix	286-288	3
β-strand	296	1	13
β-strand	299	1	13
α-helix	301-314	14
α-helix	319-335	17
β-strand	341-344	4	14
β-strand	347-349	3	14
α-helix	355-364	10
α-helix	368-376	9
β-strand	377-381	5	15
β-strand	386-390	5	15
α-helix	393-423	31
α-helix	428-429	2
β-strand	431-438	8	11
β-strand	447	1	16
α-helix	449-478	30
α-helix	484-486	3
α-helix	493-500	8
α-helix	505-514	10
α-helix	520-531	12
β-strand	538-539	2	16
β-strand	547-551	5	16
β-strand	556-560	5	16
α-helix	564-568	5
α-helix	574-581	8
α-helix	588-591	4
α-helix	630-633	4
α-helix	636-652	17
β-strand	655-662	8	11
α-helix	675-684	10
α-helix	687-696	10
β-strand	700-703	4	17
α-helix	704-710	7
α-helix	724-735	12
α-helix	739-741	3
β-strand	742-744	3	17
β-strand	748-751	4	17
α-helix	755-761	7

Chain C: 39 helices, 27 β-strands

Element	Residues	Length	Sheet
β-strand	11-17	7	18
β-strand	21-27	7	18
β-strand	38-39	2	19
β-strand	49-50	2	19
α-helix	60-61	2
β-strand	62	1	18
α-helix	63	1
α-helix	74-76	3
α-helix	82-93	12
β-strand	100-103	4	20
β-strand	105-110	6	20
α-helix	117-119	3
α-helix	121-127	7
β-strand	132	1	21
β-strand	135	1	21
α-helix	139-153	15
β-strand	157-162	6	20
α-helix	169-182	14
α-helix	194-198	5
α-helix	200-207	8
β-strand	208-211	4	22
β-strand	214-218	5	22
β-strand	221-229	9	20
β-strand	233-236	4	20
β-strand	239-242	4	20
α-helix	247-249	3
α-helix	261-267	7
α-helix	282-284	3
α-helix	286-289	4
α-helix	301-313	13
α-helix	320-335	16
α-helix	339-340	2
β-strand	341-344	4	23
β-strand	347-349	3	23
α-helix	355-364	10
α-helix	368-374	7
β-strand	377-382	6	24
β-strand	385-390	6	24
α-helix	393-423	31
α-helix	428-429	2
β-strand	431-438	8	20
α-helix	449-479	31
α-helix	484-486	3
α-helix	493-500	8
α-helix	505-513	9
α-helix	520-531	12
β-strand	538-539	2	25
β-strand	547-551	5	25
β-strand	556-560	5	25
α-helix	564-568	5
α-helix	574-582	9
α-helix	588-592	5
α-helix	631-633	3
α-helix	636-652	17
β-strand	655-662	8	20
α-helix	675-683	9
α-helix	687-695	9
β-strand	700-703	4	26
α-helix	704-711	8
α-helix	712-714	3
α-helix	717-719	3
α-helix	724-735	12
α-helix	739-741	3
β-strand	742-744	3	26
β-strand	748-751	4	26
α-helix	756-762	7

Chain D: 37 helices, 27 β-strands

Element	Residues	Length	Sheet
β-strand	13	1	27
β-strand	14-16	3	28
β-strand	22-24	3	28
β-strand	27	1	29
β-strand	39-40	2	29
β-strand	48-49	2	29
α-helix	58-61	4
β-strand	62	1	27
α-helix	63-65	3
α-helix	66-68	3
β-strand	73	1	30
α-helix	74-76	3
α-helix	82-93	12
β-strand	100-103	4	30
β-strand	106-110	5	30
α-helix	111	1
α-helix	121-125	5
β-strand	132	1	31
β-strand	135	1	31
α-helix	139-152	14
β-strand	157-163	7	30
α-helix	171-182	12
α-helix	194-198	5
α-helix	200-205	6
β-strand	208-211	4	32
β-strand	214-218	5	32
β-strand	221-228	8	30
β-strand	234-242	9	30
α-helix	247-249	3
α-helix	260-265	6
α-helix	282-284	3
α-helix	286-288	3
α-helix	301-313	13
α-helix	320-335	16
α-helix	355-364	10
α-helix	370-374	5
β-strand	377-381	5	33
β-strand	386-390	5	33
α-helix	393-423	31
β-strand	431-439	9	30
α-helix	449-479	31
α-helix	493-500	8
α-helix	505-514	10
α-helix	520-531	12
β-strand	538-539	2	34
β-strand	547-551	5	34
β-strand	556-560	5	34
α-helix	564-568	5
α-helix	574-580	7
α-helix	588-591	4
α-helix	629-633	5
α-helix	636-653	18
β-strand	655-662	8	30
α-helix	676-684	9
α-helix	687-695	9
β-strand	700-703	4	35
α-helix	704-711	8
α-helix	712-714	3
α-helix	717-719	3
α-helix	724-735	12
α-helix	739-741	3
β-strand	742-744	3	35
β-strand	748-751	4	35
α-helix	755-764	10

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Myosin va	A, B, C, D	protein	766	GALLUS GALLUS	Q02440 (AlphaFold model)

Sequence of entity 1 (A, B, C, D), FASTA

>1W8J_1 MYOSIN VA (chains A, B, C, D)
MAASELYTKYARVWIPDPEEVWKSAELLKDYKPGDKVLQLRLEEGKDLEYCLDPKTKELP
PLRNPDILVGENDLTALSYLHEPAVLHNLKVRFIDSKLIYTYCGIVLVAINPYEQLPIYG
EDIINAYSGQNMGDMDPHIFAVAEEAYKQMARDERNQSIIVSGESGAGKTVSAKYAMRYF
ATVSGSASEANVEEKVLASNPIMESIGNAKTTRNDNSSRFGKYIEIGFDKRYRIIGANMR
TYLLEKSRVVFQAEEERNYHIFYQLCASAALPEFKTLRLGNANYFHYTKQGGSPVIDGID
DAKEMVNTRQACTLLGISDSYQMGIFRILAGILHLGNVEFASRDSDSCAIPPKHDPLTIF
CDLMGVDYEEMAHWLCHRKLATATETYIKPISKLHAINARDALAKHIYANLFNWIVDHVN
KALHSTVKQHSFIGVLDIYGFETFEINSFEQFCINYANEKLQQQFNMHVFKLEQEEYMKE
QIPWTLIDFYDNQPCINLIEAKMGVLDLLDEECKMPKGSDDTWAQKLYNTHLNKCALFEK
PRLSNKAFIIKHFADKVEYQCEGFLEKNKDTVYEEQIKVLKSSKKFKLLPELFQDEEKAI
SPTSATPSGRVPLSRTPVKPAKARPGQTSKEHKKTVGHQFRNSLHLLMETLNATTPHYVR
CIKPNDFKFPFTFDEKRAVQQLRACGVLETIRISAAGFPSRWTYQEFFSRYRVLMKQKDV
LSDRKQTCKNVLEKLILDKDKYQFGKTKIFFRAGQVAYLEKIRADK

Primary citation

Three Myosin V Structures Delineate Essential Features of Chemo-Mechanical Transduction. Coureux, P.-D., Sweeney, H.L., Houdusse, A. EMBO J (2004) 23:4527. DOI 10.1038/SJ.EMBOJ.7600458 · PubMed

Other PDB entries of the same protein (UniProt Q02440 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1W7J 2.0 Å, Crystal Structure Of Myosin V Motor With Essential Light Chain + ADP-BeFx - Near Rigor
1OE9 2.05 Å, Crystal structure of Myosin V motor with essential light chain-nucleotide-free
7PMD 2.9 Å, Cryo-EM structure of the actomyosin-V complex in the post-rigor transition state…
7PME 2.9 Å, Cryo-EM structure of the actomyosin-V complex in the post-rigor transition state…
1W7I 3.0 Å, Crystal Structure Of Myosin V Motor Without nucleotide soaked in 10 mM MgADP
7PM6 3.0 Å, Cryo-EM structure of the actomyosin-V complex in the strong-ADP state (central 3er/2er)
7PM5 3.1 Å, Cryo-EM structure of the actomyosin-V complex in the strong-ADP state (central 1er)
7PLU 3.2 Å, Cryo-EM structure of the actomyosin-V complex in the rigor state (central 3er/2er)
7PLY 3.2 Å, Cryo-EM structure of the actomyosin-V complex in the rigor state (central 1er, young…
7PLZ 3.2 Å, Cryo-EM structure of the actomyosin-V complex in the rigor state (central 3er/2er, young…
7PLT 3.3 Å, Cryo-EM structure of the actomyosin-V complex in the rigor state (central 1er)
7PMG 3.3 Å, Cryo-EM structure of the actomyosin-V complex in the post-rigor transition state…

Browse structure collections

About this viewer

MolViewer shows 1W8J directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.