1W7I: Myosin va

Crystal Structure Of Myosin V Motor Without nucleotide soaked in 10 mM MgADP. Determined by X-ray diffraction at 3.0 Å resolution. Released 22 Feb 2005.

Method: X-ray diffraction
Resolution: 3.0 Å
Organisms: GALLUS GALLUS, HOMO SAPIENS
Chains: 2
Atoms: 6,910
Mol. weight: 109.12 kDa
Ligands: ADP
Released: 22 Feb 2005

Explore 1W7I in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1W7I contains 45 α-helices and 34 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 36 helices, 30 β-strands

Element	Residues	Length	Sheet
β-strand	12-17	6	1
β-strand	21-27	7	1
α-helix	30-32	3
β-strand	37-42	6	1
β-strand	45-51	7	1
α-helix	52	1
α-helix	60-61	2
β-strand	62	1	1
α-helix	63-65	3
α-helix	66-68	3
β-strand	73	1	2
α-helix	74-76	3
α-helix	82-96	15
β-strand	100-103	4	2
β-strand	106-110	5	2
α-helix	121-127	7
α-helix	132-134	3
α-helix	139-151	13
β-strand	157-162	6	2
α-helix	169-182	14
α-helix	192-207	16
β-strand	208-209	2	3
β-strand	217-218	2	3
β-strand	221-228	8	2
β-strand	234-242	9	2
α-helix	246-249	4
α-helix	260-266	7
α-helix	272-274	3
α-helix	286-289	4
α-helix	301-315	15
α-helix	319-337	19
β-strand	341-343	3	4
β-strand	347-349	3	4
α-helix	355-364	10
α-helix	368-376	9
β-strand	377-380	4	5
β-strand	387-390	4	5
α-helix	393-422	30
β-strand	431-437	7	2
β-strand	447	1	6
α-helix	449-479	31
α-helix	493-500	8
α-helix	505-514	10
α-helix	520-531	12
β-strand	532	1	7
β-strand	535	1	7
β-strand	538-539	2	6
β-strand	547-551	5	6
β-strand	556-560	5	6
α-helix	564-568	5
β-strand	569	1	8
α-helix	574-581	8
α-helix	588-591	4
β-strand	635	1	8
α-helix	636-652	17
β-strand	655-662	8	2
α-helix	675-683	9
α-helix	687-694	8
β-strand	700-703	4	9
α-helix	704-710	7
α-helix	712-714	3
α-helix	724-735	12
α-helix	739-741	3
β-strand	742-744	3	9
β-strand	748-751	4	9
α-helix	755-791	37

Chain B: 9 helices, 4 β-strands

Element	Residues	Length	Sheet
α-helix	6-18	13
β-strand	26-28	3	10
α-helix	31-38	8
α-helix	45-52	8
α-helix	57-60	4
β-strand	64-66	3	10
α-helix	67-78	12
α-helix	87-95	9
β-strand	103-105	3	11
α-helix	106-114	9
α-helix	122-128	7
β-strand	138-140	3	11
α-helix	141-149	9

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Myosin va	A	protein	795	GALLUS GALLUS	Q02440 (AlphaFold model)
Myosin light chain 1, slow-twitch muscle a isoform	B	protein	151	HOMO SAPIENS	P14649 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1W7I_1 MYOSIN VA (chains A)
MAASELYTKYARVWIPDPEEVWKSAELLKDYKPGDKVLQLRLEEGKDLEYCLDPKTKELP
PLRNPDILVGENDLTALSYLHEPAVLHNLKVRFIDSKLIYTYCGIVLVAINPYEQLPIYG
EDIINAYSGQNMGDMDPHIFAVAEEAYKQMARDERNQSIIVSGESGAGKTVSAKYAMRYF
ATVSGSASEANVEEKVLASNPIMESIGNAKTTRNDNSSRFGKYIEIGFDKRYRIIGANMR
TYLLEKSRVVFQAEEERNYHIFYQLCASAALPEFKTLRLGNANYFHYTKQGGSPVIDGID
DAKEMVNTRQACTLLGISDSYQMGIFRILAGILHLGNVEFASRDSDSCAIPPKHDPLTIF
CDLMGVDYEEMAHWLCHRKLATATETYIKPISKLHAINARDALAKHIYANLFNWIVDHVN
KALHSTVKQHSFIGVLDIYGFETFEINSFEQFCINYANEKLQQQFNMHVFKLEQEEYMKE
QIPWTLIDFYDNQPCINLIEAKMGVLDLLDEECKMPKGSDDTWAQKLYNTHLNKCALFEK
PRLSNKAFIIKHFADKVEYQCEGFLEKNKDTVYEEQIKVLKSSKKFKLLPELFQDEEKAI
SPTSATPSGRVPLSRTPVKPAKARPGQTSKEHKKTVGHQFRNSLHLLMETLNATTPHYVR
CIKPNDFKFPFTFDEKRAVQQLRACGVLETIRISAAGFPSRWTYQEFFSRYRVLMKQKDV
LSDRKQTCKNVLEKLILDKDKYQFGKTKIFFRAGQVAYLEKIRADKLRAACIRIQKTIRG
WLMRKKYMRMRRGDA

Sequence of entity 2 (B), FASTA

>1W7I_2 MYOSIN LIGHT CHAIN 1, SLOW-TWITCH MUSCLE A ISOFORM (chains B)
MIEFNKDQLEEFKEAFELFDRVGDGKILYSQCGDVMRALGQNPTNAEVLKVLGNPKSDEL
KSRRVDFETFLPMLQAVAKNRGQGTYEDYLEGFRVFDKEGNGKVMGAELRHVLTTLGEKM
TEEEVETVLAGHEDSNGCINYEAFLKHILSV

Ligands and cofactors

ID	Name	Formula	Copies
ADP	Adenosine-5'-diphosphate	C10 H15 N5 O10 P2	1

Primary citation

Three Myosin V Structures Delineate Essential Features of Chemo-Mechanical Transduction. Coureux, P.-D., Sweeney, H.L., Houdusse, A. EMBO J (2004) 23:4527. DOI 10.1038/SJ.EMBOJ.7600458 · PubMed

Other PDB entries of the same protein (UniProt Q02440 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1W7J 2.0 Å, Crystal Structure Of Myosin V Motor With Essential Light Chain + ADP-BeFx - Near Rigor
1OE9 2.05 Å, Crystal structure of Myosin V motor with essential light chain-nucleotide-free
1W8J 2.7 Å, Crystal Structure Of Myosin V Motor Domain - Nucleotide-Free
7PMD 2.9 Å, Cryo-EM structure of the actomyosin-V complex in the post-rigor transition state…
7PME 2.9 Å, Cryo-EM structure of the actomyosin-V complex in the post-rigor transition state…
7PM6 3.0 Å, Cryo-EM structure of the actomyosin-V complex in the strong-ADP state (central 3er/2er)
7PM5 3.1 Å, Cryo-EM structure of the actomyosin-V complex in the strong-ADP state (central 1er)
7PLU 3.2 Å, Cryo-EM structure of the actomyosin-V complex in the rigor state (central 3er/2er)
7PLY 3.2 Å, Cryo-EM structure of the actomyosin-V complex in the rigor state (central 1er, young…
7PLZ 3.2 Å, Cryo-EM structure of the actomyosin-V complex in the rigor state (central 3er/2er, young…
7PLT 3.3 Å, Cryo-EM structure of the actomyosin-V complex in the rigor state (central 1er)
7PMG 3.3 Å, Cryo-EM structure of the actomyosin-V complex in the post-rigor transition state…

Browse structure collections

About this viewer

MolViewer shows 1W7I directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.