1OJ6: Neuroglobin

Human brain neuroglobin three-dimensional structure. Determined by X-ray diffraction at 1.95 Å resolution. Released 11 Sept 2003.

Method: X-ray diffraction
Resolution: 1.95 Å
Organism: Homo sapiens
Chains: 4
Atoms: 4,951
Mol. weight: 70.63 kDa
Ligands: HEM
Released: 11 Sept 2003

Explore 1OJ6 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1OJ6 contains 42 α-helices and 4 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 11 helices, 0 β-strands

Element	Residues	Length
α-helix	6-17	12
α-helix	20-34	15
α-helix	36-41	6
α-helix	52-55	4
α-helix	59-77	19
α-helix	82-85	4
α-helix	86-98	13
α-helix	105-121	17
α-helix	122-124	3
α-helix	127-144	18
α-helix	145-147	3

Chain B: 10 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	6-16	11
α-helix	20-34	15
α-helix	36-41	6
β-strand	44	1	1
β-strand	47	1	1
α-helix	52-55	4
α-helix	59-77	19
α-helix	82-85	4
α-helix	86-97	12
α-helix	105-121	17
α-helix	122-124	3
α-helix	127-147	21

Chain C: 11 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	6-17	12
α-helix	20-34	15
α-helix	36-41	6
β-strand	44	1	2
β-strand	47	1	2
α-helix	52-55	4
α-helix	59-77	19
α-helix	82-85	4
α-helix	86-98	13
α-helix	105-121	17
α-helix	122-124	3
α-helix	127-144	18
α-helix	145-147	3

Chain D: 10 helices, 0 β-strands

Element	Residues	Length
α-helix	6-16	11
α-helix	20-34	15
α-helix	36-42	7
α-helix	59-77	19
α-helix	79-85	7
α-helix	86-99	14
α-helix	105-121	17
α-helix	122-124	3
α-helix	127-144	18
α-helix	145-148	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Neuroglobin	A, B, C, D	protein	151	Homo sapiens	Q9NPG2 (AlphaFold model)

Sequence of entity 1 (A, B, C, D), FASTA

>1OJ6_1 Neuroglobin (chains A, B, C, D)
MERPEPELIRQSWRAVSRSPLEHGTVLFARLFALEPDLLPLFQYNGRQFSSPEDSLSSPE
FLDHIRKVMLVIDAAVTNVEDLSSLEEYLASLGRKHRAVGVKLSSFSTVGESLLYMLEKS
LGPAFTPATRAAWSQLYGAVVQAMSRGWDGE

Ligands and cofactors

ID	Name	Formula	Copies
HEM	Protoporphyrin IX containing FE	C34 H32 Fe N4 O4	4

Water and common crystallization additives (SO4) are not listed.

Primary citation

Human Brain Neuroglobin Structure Reveals a Distinct Mode of Controlling Oxygen Affinity. Pesce, A., Dewilde, S., Nardini, M. et al. Structure (2003) 11:1087. DOI 10.1016/S0969-2126(03)00166-7 · PubMed

Other PDB entries of the same protein (UniProt Q9NPG2 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7VQG 1.35 Å, The X-ray structure of human neuroglobin A15C mutant
8WUB 1.5 Å, The X-ray structure of human neuroglobin C120S mutant
4MPM 1.74 Å, Wild-type human neuroglobin
8GRZ 2.0 Å, X-ray crystal structure of V71C human neuroglobin mutant

Browse more

1OJ6 is part of these collections:

Hemoglobin and oxygen transport

About this viewer

MolViewer shows 1OJ6 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.