Crystal structure of the dengue 2 virus envelope glycoprotein in the postfusion conformation. Determined by X-ray diffraction at 2.0 Å resolution. Released 29 Jan 2004.
Explore 1OK8 in 3D Show helices and sheets RCSB PDB PDBe
1OK8 contains 15 α-helices and 35 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 3 | 1 | |
| β-strand | 4-5 | 2 | 1 |
| α-helix | 6-7 | 2 | |
| α-helix | 8-10 | 3 | |
| β-strand | 11-13 | 3 | 2 |
| β-strand | 18-26 | 9 | 2 |
| β-strand | 31-34 | 4 | 1 |
| β-strand | 35 | 1 | 3 |
| β-strand | 40-51 | 12 | 1 |
| α-helix | 53 | 1 | |
| β-strand | 54-72 | 19 | 4 |
| α-helix | 83-86 | 4 | |
| β-strand | 90-99 | 10 | 4 |
| α-helix | 101-103 | 3 | |
| β-strand | 109-129 | 21 | 4 |
| α-helix | 132-134 | 3 | |
| β-strand | 135-143 | 9 | 1 |
| β-strand | 160-164 | 5 | 1 |
| β-strand | 170-175 | 6 | 2 |
| β-strand | 179-187 | 9 | 2 |
| β-strand | 196-201 | 6 | 4 |
| β-strand | 204-209 | 6 | 4 |
| α-helix | 210-215 | 6 | |
| β-strand | 220-222 | 3 | 4 |
| β-strand | 232 | 1 | 4 |
| α-helix | 234-236 | 3 | |
| β-strand | 238-240 | 3 | 5 |
| α-helix | 241-243 | 3 | |
| β-strand | 250-252 | 3 | 5 |
| α-helix | 257-263 | 7 | |
| β-strand | 268-270 | 3 | 4 |
| β-strand | 272 | 1 | 1 |
| β-strand | 276-279 | 4 | 1 |
| β-strand | 282-290 | 9 | 2 |
| β-strand | 294 | 1 | 3 |
| α-helix | 295-296 | 2 | |
| α-helix | 299-300 | 2 | |
| β-strand | 301 | 1 | 6 |
| α-helix | 302 | 1 | |
| β-strand | 306-314 | 9 | 7 |
| β-strand | 320-326 | 7 | 7 |
| β-strand | 333-334 | 2 | 6 |
| β-strand | 337-341 | 5 | 8 |
| β-strand | 346 | 1 | 8 |
| β-strand | 351 | 1 | 7 |
| β-strand | 357-358 | 2 | 6 |
| β-strand | 365-369 | 5 | 7 |
| α-helix | 371-372 | 2 | |
| β-strand | 374-380 | 7 | 8 |
| β-strand | 387-393 | 7 | 8 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Major envelope protein E | A | protein | 394 | DENGUE VIRUS TYPE 2 | P12823 |
>1OK8_1 MAJOR ENVELOPE PROTEIN E (chains A) MRCIGISNRDFVEGVSGGSWVDIVLEHGSCVTTMAKNKPTLDFELIKTEAKQPATLRKYC IEAKLTNTTTESRCPTQGEPTLNEEQDKRFVCKHSMVDRGWGNGCGLFGKGGIVTCAMFT CKKNMEGKIVQPENLEYTVVITPHSGEEHAVGNDTGKHGKEVKITPQSSITEAELTGYGT VTMECSPRTGLDFNEMVLLQMKDKAWLVHRQWFLDLPLPWLPGADTQGSNWIQKETLVTF KNPHAKKQDVVVLGSQEGAMHTALTGATEIQMSSGNLLFTGHLKCRLRMDKLQLKGMSYS MCTGKFKVVKEIAETQHGTIVIRVQYEGDGSPCKIPFEIMDLEKRHVLGRLITVNPIVTE KDSPVNIEAEPPFGDSYIIIGVEPGQLKLNWFKK
| ID | Name | Formula | Copies |
|---|---|---|---|
| NAG | 2-acetamido-2-deoxy-beta-D-glucopyranose | C8 H15 N O6 | 1 |
Water and common crystallization additives (CL) are not listed.
Structure of the Dengue Virus Envelope Protein After Membrane Fusion. Modis, Y., Ogata, S., Clements, D. et al. Nature (2004) 427:313. DOI 10.1038/NATURE02165 · PubMed
Other PDB entries of the same protein (UniProt P12823), best resolution first:
MolViewer shows 1OK8 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.