NS2B-NS3 protease from dengue virus in the presence of DTNB, a covalent allosteric inhibitor. Determined by X-ray diffraction at 1.74 Å resolution. Released 27 Nov 2013.
Explore 4M9T in 3D Show helices and sheets RCSB PDB PDBe
4M9T contains 5 α-helices and 16 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 49-50 | 2 | |
| β-strand | 51-57 | 7 | 1 |
| α-helix | 63-68 | 6 | |
| β-strand | 70-72 | 3 | 2 |
| α-helix | 82-84 | 3 | |
| β-strand | 1021-1029 | 9 | 1 |
| β-strand | 1032-1042 | 11 | 1 |
| β-strand | 1045-1049 | 5 | 1 |
| α-helix | 1050-1053 | 4 | |
| β-strand | 1058-1060 | 3 | 1 |
| β-strand | 1063-1065 | 3 | 1 |
| β-strand | 1067-1071 | 5 | 1 |
| β-strand | 1076-1079 | 4 | 1 |
| β-strand | 1095-1099 | 5 | 2 |
| β-strand | 1107-1111 | 5 | 2 |
| β-strand | 1114-1118 | 5 | 2 |
| β-strand | 1121-1126 | 6 | 2 |
| α-helix | 1132-1134 | 3 | |
| β-strand | 1138-1140 | 3 | 2 |
| β-strand | 1146-1156 | 11 | 2 |
| β-strand | 1161-1166 | 6 | 2 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| NS2B-NS3 protease | A | protein | 247 | Dengue virus 2 | P12823 |
>4M9T_1 NS2B-NS3 protease (chains A) GSHMLEADLELERAADVRWEEQAEISGSSPILSITISEDGSMSIKNEEEEQTLGGGGSGG GGAGVLWDVPSPPPVGKAELEDGAYRIKQKGILGYSQIGAGVYKEGTFHTMWHVTRGAVL MHKGKRIEPSWADVKKDLISYGGGWKLEGEWKEGEEVQVLALEPGKNPRAVQTKPGLFKT NTGTIGCVSLDFSPGTSGSPIVDKKGKVVGLYGNGVVTRSGAYVSAIANTEKSIEDNPEI EDDIFRK
Allosteric Inhibition of the NS2B-NS3 Protease from Dengue Virus. Yildiz, M., Ghosh, S., Bell, J.A. et al. ACS Chem Biol (2013) 8:2744-2752. DOI 10.1021/cb400612h · PubMed
Other PDB entries of the same protein (UniProt P12823), best resolution first:
MolViewer shows 4M9T directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.