1OKE: Dengue 2 virus envelope protein

Crystal structure of the dengue 2 virus envelope protein in complex with n-octyl-beta-D-glucoside. Determined by X-ray diffraction at 2.4 Å resolution. Released 24 Jul 2003.

Method: X-ray diffraction
Resolution: 2.4 Å
Organism: DENGUE VIRUS TYPE 2
Chains: 2
Atoms: 6,426
Mol. weight: 90.13 kDa
Ligands: NAG, BOG
Released: 24 Jul 2003

Explore 1OKE in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1OKE contains 16 α-helices and 70 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains A and B: 8 helices, 35 β-strands

Element	Residues	Length	Sheet
β-strand	4	1	1
β-strand	6	1	1
β-strand	9-13	5	2
β-strand	20-25	6	3
β-strand	30-35	6	2
β-strand	38-50	13	2
β-strand	54-72	19	4
α-helix	83-85	3
β-strand	90-99	10	4
α-helix	101-103	3
β-strand	109-129	21	4
α-helix	132-134	3
β-strand	135-143	9	2
β-strand	147	1	5
β-strand	160-164	5	2
β-strand	171-175	5	3
β-strand	179-186	8	3
β-strand	196-201	6	4
β-strand	204-209	6	4
α-helix	210-214	5
β-strand	220-222	3	4
β-strand	232	1	4
α-helix	234-237	4
β-strand	238-241	4	6
β-strand	249-252	4	6
α-helix	257-263	7
β-strand	268-271	4	4
β-strand	277	1	4
β-strand	283-288	6	3
β-strand	292	1	3
β-strand	301	1	7
β-strand	306-314	9	5
β-strand	320-326	7	5
β-strand	333-334	2	7
α-helix	335-336	2
β-strand	337-340	4	8
β-strand	347-349	3	8
β-strand	350-351	2	5
β-strand	357-358	2	7
β-strand	365-370	6	5
α-helix	371-372	2
β-strand	374-380	7	8
β-strand	387-393	7	8

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Major envelope protein E	A, B	protein	394	DENGUE VIRUS TYPE 2	P12823

Sequence of entity 1 (A, B), FASTA

>1OKE_1 MAJOR ENVELOPE PROTEIN E (chains A, B)
MRCIGISNRDFVEGVSGGSWVDIVLEHGSCVTTMAKNKPTLDFELIKTEAKQPATLRKYC
IEAKLTNTTTESRCPTQGEPTLNEEQDKRFVCKHSMVDRGWGNGCGLFGKGGIVTCAMFT
CKKNMEGKIVQPENLEYTVVITPHSGEEHAVGNDTGKHGKEVKITPQSSITEAELTGYGT
VTMECSPRTGLDFNEMVLLQMKDKAWLVHRQWFLDLPLPWLPGADTQGSNWIQKETLVTF
KNPHAKKQDVVVLGSQEGAMHTALTGATEIQMSSGNLLFTGHLKCRLRMDKLQLKGMSYS
MCTGKFKVVKEIAETQHGTIVIRVQYEGDGSPCKIPFEIMDLEKRHVLGRLITVNPIVTE
KDSPVNIEAEPPFGDSYIIIGVEPGQLKLNWFKK

Ligands and cofactors

ID	Name	Formula	Copies
NAG	2-acetamido-2-deoxy-beta-D-glucopyranose	C8 H15 N O6	2
BOG	octyl beta-D-glucopyranoside	C14 H28 O6	2

Primary citation

A Ligand-Binding Pocket in the Dengue Virus Envelope Glycoprotein. Modis, Y., Ogata, S., Clements, D. et al. Proc Natl Acad Sci U S A (2003) 100:6986. DOI 10.1073/PNAS.0832193100 · PubMed

Other PDB entries of the same protein (UniProt P12823), best resolution first:

4M9K 1.46 Å, NS2B-NS3 protease from dengue virus at pH 5.5
4M9M 1.53 Å, NS2B-NS3 protease from dengue virus at pH 8.5
4M9T 1.74 Å, NS2B-NS3 protease from dengue virus in the presence of DTNB, a covalent allosteric…
2P41 1.8 Å, Crystal Structure of Dengue Methyltransferase in Complex with 7MeGpppG2'OMe and…
1OK8 2.0 Å, Crystal structure of the dengue 2 virus envelope glycoprotein in the postfusion…
2P3L 2.2 Å, Crystal Structure of Dengue Methyltransferase in Complex with GpppA and…
5HHG 2.2 Å, Mouse importin alpha: Dengue 2 NS5 C-terminal NLS peptide complex
1L9K 2.4 Å, dengue methyltransferase
4M9I 2.4 Å, A125C NS2B-NS3 protease from dengue virus at pH 5.5
1R6A 2.6 Å, Structure of the dengue virus 2'O methyltransferase in complex with s-adenosyl…
4M9F 2.7 Å, Dengue virus NS2B-NS3 protease A125C variant at pH 8.5
2P40 2.7 Å, Crystal Structure of Dengue Methyltransferase in Complex with 7MeGpppG

Browse structure collections

About this viewer

MolViewer shows 1OKE directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.