5HHG: RNA-directed RNA polymerase NS5

Mouse importin alpha: Dengue 2 NS5 C-terminal NLS peptide complex. Determined by X-ray diffraction at 2.2 Å resolution. Released 18 May 2016.

Method: X-ray diffraction
Resolution: 2.2 Å
Organisms: Dengue virus type 2 (strain Puerto Rico/PR159-S1/1969), Mus musculus
Chains: 2
Atoms: 3,684
Mol. weight: 50.6 kDa
Released: 18 May 2016

Explore 5HHG in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5HHG contains 34 α-helices and 0 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain C: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	884-885	2

Chain E: 33 helices, 0 β-strands

Element	Residues	Length
α-helix	78-85	8
α-helix	90-104	15
α-helix	112-117	6
α-helix	121-128	8
α-helix	134-148	15
α-helix	152-160	9
α-helix	163-170	8
α-helix	176-191	16
α-helix	194-202	9
α-helix	206-211	6
α-helix	218-220	3
α-helix	223-237	15
α-helix	243-245	3
α-helix	246-260	15
α-helix	265-278	14
α-helix	283-290	8
α-helix	295-302	8
α-helix	307-321	15
α-helix	325-333	9
α-helix	336-339	4
α-helix	340-343	4
α-helix	349-362	14
α-helix	367-375	9
α-helix	379-387	9
α-helix	391-407	17
α-helix	410-418	9
α-helix	422-427	6
α-helix	428-430	3
α-helix	434-454	21
α-helix	457-466	10
α-helix	469-475	7
α-helix	476-478	3
α-helix	482-495	14

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
RNA-directed RNA polymerase NS5	C	protein	36	Dengue virus type 2 (strain Puerto Rico/PR159-S1/1969)	P12823
Importin subunit alpha-1	E	protein	427	Mus musculus	P52293 (AlphaFold model)

Sequence of entity 1 (C), FASTA

>5HHG_1 RNA-directed RNA polymerase NS5 (chains C)
TAINQVRSLIGNEEYTDYMPSMKRFRREEEEAGVLW

Sequence of entity 2 (E), FASTA

>5HHG_2 Importin subunit alpha-1 (chains E)
QGTVNWSVEDIVKGINSNNLESQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGK
TDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIA
GDGSAFRDLVIKHGAIDPLLALLAVPDLSTLACGYLRNLTWTLSNLCRNKNPAPPLDAVE
QILPTLVRLLHHNDPEVLADSCWAISYLTDGPNERIEMVVKKGVVPQLVKLLGATELPIV
TPALRAIGNIVTGTDEQTQKVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQI
QQVVNHGLVPFLVGVLSKADFKTQKEAAWAITNYTSGGTVEQIVYLVHCGIIEPLMNLLS
AKDTKIIQVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQRHENESVYKASLN
LIEKYFS

Primary citation

The C-terminal 18 Amino Acid Region of Dengue Virus NS5 Regulates its Subcellular Localization and Contains a Conserved Arginine Residue Essential for Infectious Virus Production. Tay, M.Y., Smith, K., Ng, I.H. et al. PLoS Pathog (2016) 12:e1005886-e1005886. DOI 10.1371/journal.ppat.1005886 · PubMed

Other PDB entries of the same protein (UniProt P12823), best resolution first:

4M9K 1.46 Å, NS2B-NS3 protease from dengue virus at pH 5.5
4M9M 1.53 Å, NS2B-NS3 protease from dengue virus at pH 8.5
4M9T 1.74 Å, NS2B-NS3 protease from dengue virus in the presence of DTNB, a covalent allosteric…
2P41 1.8 Å, Crystal Structure of Dengue Methyltransferase in Complex with 7MeGpppG2'OMe and…
1OK8 2.0 Å, Crystal structure of the dengue 2 virus envelope glycoprotein in the postfusion…
2P3L 2.2 Å, Crystal Structure of Dengue Methyltransferase in Complex with GpppA and…
1L9K 2.4 Å, dengue methyltransferase
1OKE 2.4 Å, Crystal structure of the dengue 2 virus envelope protein in complex with…
4M9I 2.4 Å, A125C NS2B-NS3 protease from dengue virus at pH 5.5
1R6A 2.6 Å, Structure of the dengue virus 2'O methyltransferase in complex with s-adenosyl…
4M9F 2.7 Å, Dengue virus NS2B-NS3 protease A125C variant at pH 8.5
2P40 2.7 Å, Crystal Structure of Dengue Methyltransferase in Complex with 7MeGpppG

Browse structure collections

About this viewer

MolViewer shows 5HHG directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.