1ONV: PDB entry 1ONV

NMR Structure of a Complex Containing the TFIIF Subunit RAP74 and the RNAP II CTD Phosphatase FCP1. Determined by solution NMR. Released 20 May 2003.

Method: Solution NMR
Organism: Homo sapiens
Chains: 2
Atoms: 704
Mol. weight: 18.37 kDa
Released: 20 May 2003

Explore 1ONV in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1ONV contains 4 α-helices and 3 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 3 β-strands

Element	Residues	Length	Sheet
α-helix	456-465	10
β-strand	468	1	1
α-helix	470-476	7
α-helix	486-500	15
β-strand	503-506	4	1
β-strand	511-514	4	1

Chain B: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	945-960	16

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Transcription initiation factor IIF, alpha subunit	A	protein	82	Homo sapiens	P35269 (AlphaFold model)
serine phosphatase FCP1a	B	protein	83	Homo sapiens	Q9Y5B0 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1ONV_1 Transcription initiation factor IIF, alpha subunit (chains A)
STPQPPSGKTTPNSGDVQVTEDAVRRYLTRKPMTTKDLLKKFQTKKTGLSSEQTVNVLAQ
ILKRLNPERKMINDKMHFSLKE

Sequence of entity 2 (B), FASTA

>1ONV_2 serine phosphatase FCP1a (chains B)
PEEQEEEPQPRKPGTRRERTLGAPASSERSAAGGRGPRGHKRKLNEEDAASESSRESSNE
DEGSSSEADEMAKALEAELNDLM

Primary citation

NMR Structure of a Complex Containing the TFIIF Subunit RAP74 and the RNA polymerase II carboxyl-terminal domain phosphatase FCP1. Nguyen, B.D., Abbott, K.L., Potempa, K. et al. Proc Natl Acad Sci U S A (2003) 100:5688-5693. DOI 10.1073/pnas.1031524100 · PubMed

Other PDB entries of the same protein (UniProt P35269 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1I27 1.02 Å, Crystal structure of the C-terminal domain of the RAP74 subunit of human transcription…
1F3U 1.7 Å, Crystal structure of the RAP30/74 interaction domains of human tfiif
1J2X 2.0 Å, Crystal structure of RAP74 C-terminal domain complexed with FCP1 C-terminal peptide
7NVU 2.5 Å, RNA polymerase II core pre-initiation complex with open promoter DNA
8WAV 2.72 Å, De novo transcribing complex 12 (TC12), the early elongation complex with Pol II…
8WAX 2.75 Å, De novo transcribing complex 14 (TC14), the early elongation complex with Pol II…
8WAZ 2.76 Å, De novo transcribing complex 16 (TC16), the early elongation complex with Pol II…
8WAU 2.78 Å, De novo transcribing complex 11 (TC11), the early elongation complex with Pol II…
7NVS 2.8 Å, RNA polymerase II core pre-initiation complex with closed promoter DNA in proximal…
8WAT 2.82 Å, De novo transcribing complex 10 (TC10), the early elongation complex with Pol II…
8WAY 2.85 Å, De novo transcribing complex 15 (TC15), the early elongation complex with Pol II…
7NVT 2.9 Å, RNA polymerase II core pre-initiation complex with closed promoter DNA in distal position

Browse structure collections

About this viewer

MolViewer shows 1ONV directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.