1OZJ: Smad3-MH1

Crystal structure of Smad3-MH1 bound to DNA at 2.4 A resolution. Determined by X-ray diffraction at 2.4 Å resolution. Released 23 Mar 2004.

Method: X-ray diffraction
Resolution: 2.4 Å
Organism: Homo sapiens
Chains: 4
Atoms: 2,730
Mol. weight: 43 kDa
Ligands: ZN
Released: 23 Mar 2004

Explore 1OZJ in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1OZJ contains 17 α-helices and 12 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 9 helices, 6 β-strands

Element	Residues	Length	Sheet
α-helix	10-16	7
α-helix	25-44	20
α-helix	48-57	10
α-helix	63-64	2
β-strand	66-68	3	1
α-helix	69-70	2
β-strand	75-77	3	2
β-strand	80-82	3	2
α-helix	84-92	9
α-helix	100-102	3
β-strand	103-105	3	3
α-helix	113-115	3
β-strand	119-121	3	1
α-helix	124-126	3
β-strand	127-129	3	3

Chain B: 8 helices, 6 β-strands

Element	Residues	Length	Sheet
α-helix	10-17	8
α-helix	26-44	19
α-helix	48-57	10
β-strand	66-68	3	4
α-helix	69-70	2
β-strand	75-77	3	5
β-strand	80-82	3	5
α-helix	84-92	9
α-helix	100-102	3
β-strand	103-105	3	6
α-helix	113-115	3
β-strand	119-121	3	4
α-helix	124-126	3
β-strand	127-129	3	6

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Smad binding element	C	DNA	15
Smad binding element	D	DNA	15
Smad 3	A, B	protein	144	Homo sapiens	P84022 (AlphaFold model)

Sequence of entity 1 (C), FASTA

>1OZJ_1 Smad binding element (chains C)
TCAGTCTAGACATAC

Sequence of entity 2 (D), FASTA

>1OZJ_2 Smad binding element (chains D)
GTATGTCTAGACTGA

Sequence of entity 3 (A, B), FASTA

>1OZJ_3 SMAD 3 (chains A, B)
MSSILPFTPPIVKRLLGWKKGEQNGQEEKWCEKAVKSLVKKLKKTGQLDELEKAITTQNV
NTKCITIPRSLDGRLQVSHRKGLPHVIYCRLWRWPDLHSHHELRAMELCEFAFNMKKDEV
CVNPYHYQRVETPVLPPVLVPRHT

Ligands and cofactors

ID	Name	Formula	Copies
ZN	Zinc ion	Zn	2

Primary citation

Features of a Smad3 MH1-DNA complex. Roles of water and zinc in DNA binding. Chai, J., Wu, J.-W., Yan, N. et al. J Biol Chem (2003) 278:20327-20331. DOI 10.1074/jbc.C300134200 · PubMed

Other PDB entries of the same protein (UniProt P84022 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6YIB 1.7 Å, 14-3-3 sigma in complex with SMAD3 pS423 peptide
1MJS 1.91 Å, MH2 domain of transcriptional factor SMAD3
5OD6 2.0 Å, Crystal structure of Smad3-MH1 bound to the GGCGC site.
5ODG 2.12 Å, Crystal structure of Smad3-MH1 bound to the GGCT site.
6ZMN 2.33 Å, Crystal structure of the Smad3-Smad5 MH1 domain chimera bound to the GGCGC site
5XOC 2.4 Å, Crystal structure of human Smad3-FoxH1 complex
1U7F 2.6 Å, Crystal Structure of the phosphorylated Smad3/Smad4 heterotrimeric complex
1MK2 2.74 Å, SMAD3 SBD complex
1MHD 2.8 Å, Crystal structure of a smad MH1 domain bound to DNA
2LAJ Third WW domain of human Nedd4L in complex with doubly phosphorylated human smad3…
2LB2 Structure of the second domain of human Nedd4L in complex with a phosphorylated pTPY…

Browse structure collections

About this viewer

MolViewer shows 1OZJ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.