1P8D: Oxysterols receptor LXR-beta

X-Ray Crystal Structure of LXR Ligand Binding Domain with 24(S),25-epoxycholesterol. Determined by X-ray diffraction at 2.8 Å resolution. Released 8 Jul 2003.

Method: X-ray diffraction
Resolution: 2.8 Å
Organism: Homo sapiens
Chains: 4
Atoms: 4,273
Mol. weight: 63.88 kDa
Ligands: CO1
Released: 8 Jul 2003

Explore 1P8D in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1P8D contains 24 α-helices and 6 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 10 helices, 3 β-strands

Element	Residues	Length	Sheet
α-helix	222-243	22
α-helix	267-286	20
α-helix	292-294	3
α-helix	297-318	22
β-strand	320	1	1
β-strand	327-330	4	1
β-strand	333-335	3	1
α-helix	337-342	6
α-helix	347-363	17
α-helix	367-378	12
α-helix	389-410	22
α-helix	417-442	26
α-helix	451-457	7

Chain B: 12 helices, 3 β-strands

Element	Residues	Length	Sheet
α-helix	222-243	22
α-helix	246-247	2
α-helix	250-253	4
α-helix	261-286	26
α-helix	292-294	3
α-helix	297-318	22
β-strand	320	1	2
β-strand	327-328	2	2
β-strand	334-335	2	2
α-helix	337-342	6
α-helix	347-361	15
α-helix	367-378	12
α-helix	389-410	22
α-helix	417-441	25
α-helix	451-457	7

Chain C: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	3-10	8

Chain D: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	3-11	9

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Oxysterols receptor LXR-beta	A, B	protein	250	Homo sapiens	P55055 (AlphaFold model)
nuclear receptor coactivator 1 isoform 3	C, D	protein	25		Q15788 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>1P8D_1 Oxysterols receptor LXR-beta (chains A, B)
GSEGEGVQLTAAQELMIQQLVAAQLQCNKRSFSDQPKVTPWPLGADPQSRDARQQRFAHF
TELAIISVQEIVDFAKQVPGFLQLGREDQIALLKASTIEIMLLETARRYNHETECITFLK
DFTYSKDDFHRAGLQVEFINPIFEFSRAMRRLGLDDAEYALLIAINIFSADRPNVQEPGR
VEALQQPYVEALLSYTRIKRPQDQLRFPRMLMKLVSLRTLSSVHSEQVFALRLQDKKLPP
LLSEIWDVHE

Sequence of entity 2 (C, D), FASTA

>1P8D_2 nuclear receptor coactivator 1 isoform 3 (chains C, D)
CPSSHSSLTERHKILHRLLQEGSPS

Ligands and cofactors

ID	Name	Formula	Copies
CO1	17-[3-(3,3-dimethyl-oxiranyl)-1-methyl-propyl]-10,13-dimethyl-2,3,4,7,8,9,10,11…	C27 H44 O2	2

Primary citation

X-ray crystal structure of the liver X receptor beta ligand binding domain: regulation by a histidine-tryptophan switch. Williams, S., Bledsoe, R.K., Collins, J.L. et al. J Biol Chem (2003) 278:27138-27143. DOI 10.1074/jbc.M302260200 · PubMed

Other PDB entries of the same protein (UniProt P55055 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6S5K 1.6 Å, LXRbeta ligand binding domain in complex with small molecule inhibitors
6S4N 1.9 Å, LXRbeta ligand binding domain in comlpex with small molecule inhibitors
6S4T 2.0 Å, LXRbeta ligand binding domain in comlpex with small molecule inhibitors
4RAK 2.04 Å, Crystal structure of nuclear receptor subfamily 1, group h, member 2 (lxrb) complexed…
1PQ9 2.1 Å, Human lxr beta hormone receptor complexed with T0901317 complex
1UPV 2.1 Å, Crystal structure of the human Liver X receptor beta ligand binding domain in complex…
3L0E 2.3 Å, X-ray crystal structure of a Potent Liver X Receptor Modulator
1PQ6 2.4 Å, Human lxr beta hormone receptor / GW3965 complex
1UPW 2.4 Å, Crystal structure of the human Liver X receptor beta ligand binding domain in complex…
3KFC 2.4 Å, Complex Structure of LXR with an agonist
5JY3 2.4 Å, Crystal structure of lxrbeta (nuclear receptor subfamily 1, group H, member 2) complexed…
4DK7 2.45 Å, Crystal structure of LXR ligand binding domain in complex with full agonist 1

Browse structure collections

About this viewer

MolViewer shows 1P8D directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.