1POZ: Hyaluronan binding domain of human CD44

Solution structure of the hyaluronan binding domain of human CD44. Determined by solution NMR. Released 16 Mar 2004.

Method: Solution NMR
Organism: Homo sapiens
Chains: 1
Atoms: 1,233
Mol. weight: 17.6 kDa
Released: 16 Mar 2004

Explore 1POZ in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1POZ contains 3 α-helices and 19 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 19 β-strands

Element	Residues	Length	Sheet
β-strand	21-23	3	1
β-strand	24	1	2
β-strand	26	1	3
β-strand	29-30	2	4
β-strand	33-34	2	4
β-strand	36	1	5
β-strand	38	1	2
β-strand	44	1	6
α-helix	46-55	10
β-strand	58-59	2	4
α-helix	63-71	9
β-strand	80-81	2	5
β-strand	86-87	2	5
β-strand	114	1	6
β-strand	115-116	2	5
β-strand	119-120	2	4
β-strand	128	1	4
β-strand	139-146	8	1
β-strand	147-149	3	3
β-strand	153-155	3	3
β-strand	158-160	3	1
α-helix	165-167	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
CD44 antigen	A	protein	159	Homo sapiens	P16070 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1POZ_1 CD44 antigen (chains A)
AQIDLNITCRFAGVFHVEKNGRYSISRTEAADLCKAFNSTLPTMAQMEKALSIGFETCRY
GFIEGHVVIPRIHPNSICAANNTGVYILTSNTSQYDTYCFNASAPPEEDCTSVTDLPNAF
DGPITITIVNRDGTRYVQKGEYRTNPEDIYPSNPTDDDV

Primary citation

Structure of the Regulatory Hyaluronan Binding Domain in the Inflammatory Leukocyte Homing Receptor CD44. Teriete, P., Banerji, S., Noble, M. et al. Mol Cell (2004) 13:483-496. DOI 10.1016/S1097-2765(04)00080-2 · PubMed

Other PDB entries of the same protein (UniProt P16070 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4PZ3 1.08 Å, High-resolution crystal structure of the human CD44 hyaluronan binding domain complex…
4PZ4 1.6 Å, High-resolution crystal structure of the human CD44 hyaluronan binding domain in new…
32NZ 1.8 Å, An activating H90 ScFv bound to the hyaluronan-binding domain of human CD44
1UUH 2.2 Å, Hyaluronan binding domain of human CD44
6TXS 2.2 Å, The structure of the FERM domain and helical linker of human moesin bound to a CD44…
2I83 hyaluronan-binding domain of CD44 in its ligand-bound form

Browse structure collections

About this viewer

MolViewer shows 1POZ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.