1PQC: Human lxr beta hormone receptor

Human lxr beta hormone receptor complexed with T0901317. Determined by X-ray diffraction at 2.8 Å resolution. Released 9 Sept 2003.

Method: X-ray diffraction
Resolution: 2.8 Å
Organism: Homo sapiens
Chains: 4
Atoms: 7,782
Mol. weight: 118.15 kDa
Ligands: 444
Released: 9 Sept 2003

Explore 1PQC in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1PQC contains 44 α-helices and 12 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 12 helices, 3 β-strands

Element	Residues	Length	Sheet
α-helix	222-243	22
α-helix	246-247	2
α-helix	262-286	25
α-helix	292-294	3
α-helix	297-318	22
β-strand	320-321	2	1
β-strand	326-330	5	1
β-strand	333-336	4	1
α-helix	337-342	6
α-helix	347-363	17
α-helix	367-378	12
α-helix	389-410	22
α-helix	417-443	27
α-helix	448-450	3
α-helix	451-457	7

Chain B: 12 helices, 3 β-strands

Element	Residues	Length	Sheet
α-helix	222-238	17
α-helix	240-244	5
α-helix	262-288	27
α-helix	292-294	3
α-helix	297-318	22
β-strand	320-321	2	2
β-strand	326-329	4	2
β-strand	333-336	4	2
α-helix	337-342	6
α-helix	347-363	17
α-helix	367-378	12
α-helix	389-410	22
α-helix	417-443	27
α-helix	448-450	3
α-helix	451-457	7

Chain C: 10 helices, 3 β-strands

Element	Residues	Length	Sheet
α-helix	222-238	17
α-helix	261-287	27
α-helix	292-294	3
α-helix	297-318	22
β-strand	320-321	2	3
β-strand	326-330	5	3
β-strand	333-335	3	3
α-helix	337-342	6
α-helix	347-363	17
α-helix	367-378	12
α-helix	389-410	22
α-helix	417-443	27
α-helix	451-457	7

Chain D: 10 helices, 3 β-strands

Element	Residues	Length	Sheet
α-helix	222-241	20
α-helix	261-288	28
α-helix	292-294	3
α-helix	297-318	22
β-strand	320-321	2	4
β-strand	326-327	2	4
β-strand	335	1	4
α-helix	337-342	6
α-helix	347-363	17
α-helix	367-378	12
α-helix	389-410	22
α-helix	417-442	26
α-helix	451-457	7

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Oxysterols receptor LXR-beta	A, B, C, D	protein	253	Homo sapiens	P55055 (AlphaFold model)

Sequence of entity 1 (A, B, C, D), FASTA

>1PQC_1 Oxysterols receptor LXR-beta (chains A, B, C, D)
GSHMGEGEGVQLTAAQELMIQQLVAAQLQCNKRSFSDQPKVTPWPLGADPQSRDARQQRF
AHFTELAIISVQEIVDFAKQVPGFLQLGREDQIALLKASTIEIMLLETARRYNHETECIT
FLKDFTYSKDDFHRAGLQVEFINPIFEFSRAMRRLGLDDAEYALLIAINIFSADRPNVQE
PGRVEALQQPYVEALLSYTRIKRPQDQLRFPRMLMKLVSLRTLSSVHSEQVFALRLQDKK
LPPLLSEIWDVHE

Ligands and cofactors

ID	Name	Formula	Copies
444	N-(2,2,2-trifluoroethyl)-N-{4-[2,2,2-trifluoro-1-hydroxy-1-(trifluoromethyl)eth…	C17 H12 F9 N O3 S	4

Primary citation

The three-dimensional structure of the liver X receptor beta reveals a flexible ligand-binding pocket that can accommodate fundamentally different ligands. Farnegardh, M., Bonn, T., Sun, S. et al. J Biol Chem (2003) 278:38821-38828. DOI 10.1074/jbc.M304842200 · PubMed

Other PDB entries of the same protein (UniProt P55055 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6S5K 1.6 Å, LXRbeta ligand binding domain in complex with small molecule inhibitors
6S4N 1.9 Å, LXRbeta ligand binding domain in comlpex with small molecule inhibitors
6S4T 2.0 Å, LXRbeta ligand binding domain in comlpex with small molecule inhibitors
4RAK 2.04 Å, Crystal structure of nuclear receptor subfamily 1, group h, member 2 (lxrb) complexed…
1PQ9 2.1 Å, Human lxr beta hormone receptor complexed with T0901317 complex
1UPV 2.1 Å, Crystal structure of the human Liver X receptor beta ligand binding domain in complex…
3L0E 2.3 Å, X-ray crystal structure of a Potent Liver X Receptor Modulator
1PQ6 2.4 Å, Human lxr beta hormone receptor / GW3965 complex
1UPW 2.4 Å, Crystal structure of the human Liver X receptor beta ligand binding domain in complex…
3KFC 2.4 Å, Complex Structure of LXR with an agonist
5JY3 2.4 Å, Crystal structure of lxrbeta (nuclear receptor subfamily 1, group H, member 2) complexed…
4DK7 2.45 Å, Crystal structure of LXR ligand binding domain in complex with full agonist 1

Browse structure collections

About this viewer

MolViewer shows 1PQC directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.