1QCS: N-ethylmaleimide sensitive factor

N-terminal domain of N-ethylmaleimide sensitive factor (NSF). Determined by X-ray diffraction at 1.9 Å resolution. Released 18 May 1999.

Method: X-ray diffraction
Resolution: 1.9 Å
Organism: Cricetulus griseus
Chains: 1
Atoms: 1,662
Mol. weight: 23.84 kDa
Released: 18 May 1999

Explore 1QCS in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1QCS contains 9 α-helices and 17 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 9 helices, 17 β-strands

Element	Residues	Length	Sheet
β-strand	4-10	7	1
α-helix	14-19	6
α-helix	21	1
β-strand	22-24	3	1
β-strand	34-40	7	1
β-strand	43-51	9	1
α-helix	56	1
β-strand	59-62	4	1
α-helix	64-70	7
β-strand	77-83	7	1
α-helix	87-90	4
β-strand	91	1	2
β-strand	92-101	10	3
α-helix	104-106	3
β-strand	111-113	3	4
α-helix	114-125	12
β-strand	129-131	3	2
β-strand	135-140	6	3
β-strand	143-154	12	3
α-helix	155-158	4
β-strand	171	1	3
β-strand	174-176	3	2
β-strand	182-187	6	3
α-helix	188	1
β-strand	194-196	3	4
β-strand	200	1	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
N-ethylmaleimide sensitive factor (nsf-N)	A	protein	211	Cricetulus griseus	P18708 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1QCS_1 N-ETHYLMALEIMIDE SENSITIVE FACTOR (NSF-N) (chains A)
GSHNMAGRSMQAARCPTDELSLSNCAVVSEKDYQSGQHVIVRTSPNHKYIFTLRTHPSVV
PGSVAFSLPQRKWAGLSIGQEIEVALYSFDKAKQCIGTMTIEIDFLQKKNIDSNPYDTDK
MAAEFIQQFNNQAFSVGQQLVFSFNDKLFGLLVKDIEAMDPSILKGEPASGKRQKIEVGL
VVGNSQVAFEKAENSSLNLIGKAKTKENRLE

Primary citation

NSF N-terminal domain crystal structure: models of NSF function. Yu, R.C., Jahn, R., Brunger, A.T. Mol Cell (1999) 4:97-107. DOI 10.1016/S1097-2765(00)80191-4 · PubMed

Other PDB entries of the same protein (UniProt P18708 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1D2N 1.75 Å, D2 domain of N-ethylmaleimide-sensitive fusion protein
1NSF 1.9 Å, D2 hexamerization domain of N-ethylmaleimide sensitive factor (NSF)
1QDN 2.3 Å, Amino terminal domain of the N-ethylmaleimide sensitive fusion protein (NSF)
9OJR 2.95 Å, 21bin20S complex (NSF-alphaSNAP-2:1 syntaxin-1a:SNAP-25), non-hydrolyzing, class 3
9OJU 2.97 Å, 21bin20S complex (NSF-alphaSNAP-2:1 syntaxin-1a:SNAP-25), non-hydrolyzing, class 4
9PFF 3.09 Å, Min22bin20S complex (NSF-alphaSNAP-2:2 syntaxin-1a H3:SNAP-25 SN1), non-hydrolyzing,…
9PFC 3.15 Å, NSF, substrate free, hydrolyzing, class 26
9OK5 3.29 Å, 22bin20S complex (NSF-alphaSNAP-2:2 syntaxin-1a:SNAP-25), hydrolyzing, class 16
9OJZ 3.39 Å, 21bin20S complex (NSF-alphaSNAP-2:1 syntaxin-1a:SNAP-25), non-hydrolyzing, class 5
9PB9 3.45 Å, 21bin20S complex (NSF-alphaSNAP-2:1 syntaxin-1a:SNAP-25), non-hydrolyzing, class 8
9PBA 3.47 Å, 21bin20S complex (NSF-alphaSNAP-2:1 syntaxin-1a:SNAP-25), non-hydrolyzing, class 9
9OLJ 3.52 Å, 22bin20S complex (NSF-alphaSNAP-2:2 syntaxin-1a:SNAP-25), hydrolyzing, class 18

Browse structure collections

About this viewer

MolViewer shows 1QCS directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.