1QDN: Protein)

Name: PDB 1QDN: Amino terminal domain of the N-ethylmaleimide sensitive fusion protein (NSF)
Published: 1999-06-21
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: fusion protein

Amino terminal domain of the N-ethylmaleimide sensitive fusion protein (NSF). Determined by X-ray diffraction at 2.3 Å resolution. Released 21 Jun 1999.

Method: X-ray diffraction
Resolution: 2.3 Å
Organism: Cricetulus griseus
Chains: 3
Atoms: 4,742
Mol. weight: 68.75 kDa
Released: 21 Jun 1999

Explore 1QDN in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1QDN contains 22 α-helices and 51 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 9 helices, 17 β-strands

Element	Residues	Length	Sheet
β-strand	4-9	6	1
α-helix	14-17	4
α-helix	21	1
β-strand	22-24	3	1
β-strand	34-40	7	1
β-strand	43-51	9	1
α-helix	56	1
β-strand	59-61	3	1
α-helix	64-70	7
β-strand	77-83	7	1
α-helix	88-90	3
β-strand	91	1	2
β-strand	94-101	8	3
α-helix	104-106	3
β-strand	111-113	3	4
α-helix	114-125	12
β-strand	129-131	3	2
β-strand	135-140	6	3
β-strand	143-153	11	3
α-helix	154-156	3
β-strand	171	1	3
β-strand	174-176	3	2
β-strand	182-187	6	3
α-helix	188	1
β-strand	194-196	3	4
β-strand	200	1	3

Chain B: 6 helices, 17 β-strands

Element	Residues	Length	Sheet
β-strand	4-10	7	5
α-helix	15-19	5
β-strand	22-24	3	5
β-strand	34-40	7	5
β-strand	43-51	9	5
α-helix	56	1
β-strand	59-62	4	5
α-helix	64-69	6
β-strand	77-83	7	5
α-helix	88-90	3
β-strand	91	1	6
β-strand	94-101	8	7
β-strand	111-113	3	8
α-helix	114-125	12
β-strand	129-131	3	6
β-strand	135-140	6	7
β-strand	143-153	11	7
β-strand	171	1	7
β-strand	174-176	3	6
β-strand	182-187	6	7
α-helix	188	1
β-strand	194-196	3	8
β-strand	200	1	7

Chain C: 7 helices, 17 β-strands

Element	Residues	Length	Sheet
β-strand	4-10	7	9
α-helix	15-19	5
α-helix	21	1
β-strand	22-24	3	9
β-strand	34-40	7	9
β-strand	43-51	9	9
α-helix	56	1
β-strand	59-62	4	9
α-helix	64-69	6
β-strand	77-83	7	9
α-helix	88-90	3
β-strand	91	1	10
β-strand	94-101	8	11
β-strand	111-113	3	12
α-helix	114-125	12
β-strand	129-131	3	10
β-strand	135-140	6	11
β-strand	143-153	11	11
β-strand	171	1	11
β-strand	174-176	3	10
β-strand	182-187	6	11
α-helix	188	1
β-strand	194-196	3	12
β-strand	200	1	11

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Protein (N-ethylmaleimide sensitive fusion protein (nsf))	A, B, C	protein	204	Cricetulus griseus	P18708 (AlphaFold model)

Sequence of entity 1 (A, B, C), FASTA

>1QDN_1 PROTEIN (N-ETHYLMALEIMIDE SENSITIVE FUSION PROTEIN (NSF)) (chains A, B, C)
TMAGRSMQAARCPTDELSLSNCAVVSEKDYQSGQHVIVRTSPNHKYIFTLRTHPSVVPGS
VAFSLPQRKWAGLSIGQEIEVALYSFDKAKQCIGTMTIEIDFLQKKNIDSNPYDTDKMAA
EFIQQFNNQAFSVGQQLVFSFNDKLFGLLVKDIEAMDPSILKGEPASGKRQKIEVGLVVG
NSQVAFEKAENSSLNLIGKAKTKE

Primary citation

Crystal structure of the amino-terminal domain of N-ethylmaleimide-sensitive fusion protein. May, A.P., Misura, K.M., Whiteheart, S.W. et al. Nat Cell Biol (1999) 1:175-182. DOI 10.1038/11097 · PubMed

Other PDB entries of the same protein (UniProt P18708 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1D2N 1.75 Å, D2 domain of N-ethylmaleimide-sensitive fusion protein
1NSF 1.9 Å, D2 hexamerization domain of N-ethylmaleimide sensitive factor (NSF)
1QCS 1.9 Å, N-terminal domain of N-ethylmaleimide sensitive factor (NSF)
9OJR 2.95 Å, 21bin20S complex (NSF-alphaSNAP-2:1 syntaxin-1a:SNAP-25), non-hydrolyzing, class 3
9OJU 2.97 Å, 21bin20S complex (NSF-alphaSNAP-2:1 syntaxin-1a:SNAP-25), non-hydrolyzing, class 4
9PFF 3.09 Å, Min22bin20S complex (NSF-alphaSNAP-2:2 syntaxin-1a H3:SNAP-25 SN1), non-hydrolyzing,…
9PFC 3.15 Å, NSF, substrate free, hydrolyzing, class 26
9OK5 3.29 Å, 22bin20S complex (NSF-alphaSNAP-2:2 syntaxin-1a:SNAP-25), hydrolyzing, class 16
9OJZ 3.39 Å, 21bin20S complex (NSF-alphaSNAP-2:1 syntaxin-1a:SNAP-25), non-hydrolyzing, class 5
9PB9 3.45 Å, 21bin20S complex (NSF-alphaSNAP-2:1 syntaxin-1a:SNAP-25), non-hydrolyzing, class 8
9PBA 3.47 Å, 21bin20S complex (NSF-alphaSNAP-2:1 syntaxin-1a:SNAP-25), non-hydrolyzing, class 9
9OLJ 3.52 Å, 22bin20S complex (NSF-alphaSNAP-2:2 syntaxin-1a:SNAP-25), hydrolyzing, class 18

Browse structure collections

About this viewer

MolViewer shows 1QDN directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.