1QGK: Importin beta

Structure of importin beta bound to the ibb domain of importin alpha. Determined by X-ray diffraction at 2.5 Å resolution. Released 24 May 1999.

Method: X-ray diffraction
Resolution: 2.5 Å
Organism: Homo sapiens
Chains: 2
Atoms: 7,229
Mol. weight: 102.71 kDa
Released: 24 May 1999

Explore 1QGK in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1QGK contains 64 α-helices and 0 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 62 helices, 0 β-strands

Element	Residues	Length
α-helix	3-9	7
α-helix	15-31	17
α-helix	33-44	12
α-helix	51-65	15
α-helix	70-81	12
α-helix	85-96	12
α-helix	108-120	13
α-helix	121-123	3
α-helix	129-138	10
α-helix	144-160	17
α-helix	163-165	3
α-helix	170-181	12
α-helix	188-201	14
α-helix	202-204	3
α-helix	206-209	4
α-helix	212-225	14
α-helix	231-247	17
α-helix	249-251	3
α-helix	253-255	3
α-helix	256-260	5
α-helix	261-268	8
α-helix	273-302	30
α-helix	314-329	16
α-helix	330-332	3
α-helix	344-359	16
α-helix	360-363	4
α-helix	364-374	11
α-helix	380-392	13
α-helix	399-407	9
α-helix	410-416	7
α-helix	422-438	17
α-helix	440-442	3
α-helix	449-459	11
α-helix	464-485	22
α-helix	486-488	3
α-helix	500-502	3
α-helix	503-514	12
α-helix	521-523	3
α-helix	524-537	14
α-helix	541-543	3
α-helix	544-562	19
α-helix	571-592	22
α-helix	600-616	17
α-helix	622-639	18
α-helix	640-643	4
α-helix	644-660	17
α-helix	664-681	18
α-helix	682-685	4
α-helix	686-700	15
α-helix	707-709	3
α-helix	710-724	15
α-helix	725-728	4
α-helix	732-743	12
α-helix	752-755	4
α-helix	758-776	19
α-helix	786-789	4
α-helix	791-793	3
α-helix	794-806	13
α-helix	812-829	18
α-helix	831-837	7
α-helix	842-852	11
α-helix	856-873	18

Chain B: 2 helices, 0 β-strands

Element	Residues	Length	Sheet
α-helix	14-16	3
α-helix	24-51	28

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Protein (importin beta subunit)	A	protein	876	Homo sapiens	Q14974 (AlphaFold model)
Protein (importin alpha-2 subunit)	B	protein	44		P52292 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1QGK_1 PROTEIN (IMPORTIN BETA SUBUNIT) (chains A)
MELITILEKTVSPDRLELEAAQKFLERAAVENLPTFLVELSRVLANPGNSQVARVAAGLQ
IKNSLTSKDPDIKAQYQQRWLAIDANARREVKNYVLHTLGTETYRPSSASQCVAGIACAE
IPVNQWPELIPQLVANVTNPNSTEHMKESTLEAIGYICQDIDPEQLQDKSNEILTAIIQG
MRKEEPSNNVKLAATNALLNSLEFTKANFDKESERHFIMQVVCEATQCPDTRVRVAALQN
LVKIMSLYYQYMETYMGPALFAITIEAMKSDIDEVALQGIEFWSNVCDEEMDLAIEASEA
AEQGRPPEHTSKFYAKGALQYLVPILTQTLTKQDENDDDDDWNPCKAAGVCLMLLATCCE
DDIVPHVLPFIKEHIKNPDWRYRDAAVMAFGCILEGPEPSQLKPLVIQAMPTLIELMKDP
SVVVRDTAAWTVGRICELLPEAAINDVYLAPLLQCLIEGLSAEPRVASNVCWAFSSLAEA
AYEAADVADDQEEPATYCLSSSFELIVQKLLETTDRPDGHQNNLRSSAYESLMEIVKNSA
KDCYPAVQKTTLVIMERLQQVLQMESHIQSTSDRIQFNDLQSLLCATLQNVLRKVQHQDA
LQISDVVMASLLRMFQSTAGSGGVQEDALMAVSTLVEVLGGEFLKYMEAFKPFLGIGLKN
YAEYQVCLAAVGLVGDLCRALQSNIIPFCDEVMQLLLENLGNENVHRSVKPQILSVFGDI
ALAIGGEFKKYLEVVLNTLQQASQAQVDKSDYDMVDYLNELRESCLEAYTGIVQGLKGDQ
ENVHPDVMLVQPRVEFILSFIDHIAGDEDHTDGVVACAAGLIGDLCTAFGKDVLKLVEAR
PMIHELLTEGRRSKTNKAKTLARWATKELRKLKNQA

Sequence of entity 2 (B), FASTA

>1QGK_2 PROTEIN (IMPORTIN ALPHA-2 SUBUNIT) (chains B)
AARLHRFKNKGKDSTEMRRRRIEVNVELRKAKKDDQMLKRRNVS

Primary citation

Structure of importin-beta bound to the IBB domain of importin-alpha. Cingolani, G., Petosa, C., Weis, K. et al. Nature (1999) 399:221-229. DOI 10.1038/20367 · PubMed

Other PDB entries of the same protein (UniProt Q14974 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1IBR 2.3 Å, Complex of ran with importin beta
1QGR 2.3 Å, Structure of importin beta bound to the ibb domain of importin alpha (II crystal form,…
2P8Q 2.35 Å, Crystal Structure of human Importin beta bound to the Snurportin1 IBB-domain
3W5K 2.6 Å, Crystal structure of Snail1 and importin beta complex
9N85 2.6 Å, Cryo-EM structure of human importin beta:Ran-GTP:RanBP1 trimeric complex
1F59 2.8 Å, Importin-beta-fxfg nucleoporin complex
1O6O 2.8 Å, Importin Beta aa1-442 bound to five FxFG repeats from yeast Nsp1p. Second crystal form
1O6P 2.8 Å, Importin Beta bound to a GLFG Nucleoporin peptide
2QNA 2.84 Å, Crystal structure of human Importin-beta (127-876) in complex with the IBB-domain of…
1M5N 2.9 Å, Crystal structure of HEAT repeats (1-11) of importin b bound to the non-classical…
3LWW 3.15 Å, Structure of an open and closed conformation of Human Importin Beta bound to the…
2Q5D 3.2 Å, Crystal Structure of Human Importin Beta bound to the Snurportin1 IBB-domain second…

Browse structure collections

About this viewer

MolViewer shows 1QGK directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.