1QKR: Vinculin tail and a pathway for activation

Crystal structure of the vinculin tail and a pathway for activation. Determined by X-ray diffraction at 1.8 Å resolution. Released 4 Aug 2000.

Method: X-ray diffraction
Resolution: 1.8 Å
Organism: GALLUS GALLUS
Chains: 2
Atoms: 3,131
Mol. weight: 43.45 kDa
Released: 4 Aug 2000

Explore 1QKR in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1QKR contains 18 α-helices and 4 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 10 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	882-889	8
α-helix	892-895	4
α-helix	897-909	13
β-strand	912	1	1
α-helix	918-936	19
α-helix	941-943	3
α-helix	944-971	28
α-helix	975-985	11
α-helix	988-1005	18
α-helix	1013-1044	32
α-helix	1052-1054	3
β-strand	1060	1	1

Chain B: 8 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	886-889	4
α-helix	892-895	4
α-helix	897-909	13
β-strand	912	1	2
α-helix	918-938	21
α-helix	944-971	28
α-helix	975-986	12
α-helix	988-1005	18
α-helix	1013-1044	32
β-strand	1060	1	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Vinculin	A, B	protein	188	GALLUS GALLUS	P12003 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>1QKR_1 VINCULIN (chains A, B)
EEKDEEFPEQKAGEAINQPMMMAARQLHDEARKWSSKGNDIIAAAKRMALLMAEMSRLVR
GGSGNKRALIQCAKDIAKASDEVTRLAKEVAKQCTDKRIRTNLLQVCERIPTISTQLKIL
STVKATMLGRTNISDEESEQATEMLVHNAQNLMQSVKETVREAEAASIKIRTDAGFTLRW
VRKTPWYQ

Primary citation

Crystal Structure of the Vinculin Tail and a Pathway for Activation. Bakolitsa, C., De Pereda, J.M., Bagshaw, C.R. et al. Cell (1999) 99:603. DOI 10.1016/S0092-8674(00)81549-4 · PubMed

Other PDB entries of the same protein (UniProt P12003 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1ZVZ 1.8 Å, Vinculin Head (0-258) in Complex with the Talin Rod Residue 820-844
1T01 2.06 Å, Vinculin complexed with the VBS1 helix from talin
1ZW2 2.1 Å, Vinculin Head (0-258) in Complex with the Talin Rod residues 2345-2369
3ZDL 2.3 Å, Vinculin head (1-258) in complex with a RIAM fragment
4E17 2.3 Å, Alpha-E-catenin is an autoinhibited molecule that co-activates vinculin
1U6H 2.38 Å, Vinculin head (0-258) in complex with the talin vinculin binding site 2 (849-879)
4E18 2.4 Å, Alpha-E-catenin is an autoinhibited molecule that co-activates vinculin
1XWJ 2.6 Å, Vinculin head (1-258) in complex with the talin vinculin binding site 3 (1945-1969)
2GDC 2.74 Å, Structure of Vinculin VD1 / IpaA560-633 complex
6FQ4 2.89 Å, Structure of Chlamydial virulence factor TarP and vinculin head domain
6NR7 3.0 Å, Rerefinement of chicken vinculin
1ST6 3.1 Å, Crystal structure of a cytoskeletal protein

Browse structure collections

About this viewer

MolViewer shows 1QKR directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.